Protein Info for GFF2213 in Variovorax sp. SCN45

Annotation: Flp pilus assembly protein, pilin Flp

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 61 transmembrane" amino acids 17 to 37 (21 residues), see Phobius details PF04964: Flp_Fap" amino acids 8 to 55 (48 residues), 59.8 bits, see alignment E=9e-21

Best Hits

KEGG orthology group: K02651, pilus assembly protein Flp/PilA (inferred from 66% identity to vap:Vapar_4442)

Predicted SEED Role

"Flp pilus assembly protein, pilin Flp" in subsystem Widespread colonization island

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (61 amino acids)

>GFF2213 Flp pilus assembly protein, pilin Flp (Variovorax sp. SCN45)
MLNSIARFLRDEEGATAIEYGIIAGLVAVAIVASLNGTNGLGTKLAGLFTYIAGKVTAPA
S