Protein Info for GFF221 in Variovorax sp. SCN45

Annotation: Ribosome-binding factor A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 123 TIGR00082: ribosome-binding factor A" amino acids 10 to 114 (105 residues), 88.9 bits, see alignment E=1.6e-29 PF02033: RBFA" amino acids 11 to 112 (102 residues), 108 bits, see alignment E=1.5e-35

Best Hits

Swiss-Prot: 98% identical to RBFA_VARPS: Ribosome-binding factor A (rbfA) from Variovorax paradoxus (strain S110)

KEGG orthology group: K02834, ribosome-binding factor A (inferred from 98% identity to vap:Vapar_2749)

Predicted SEED Role

"Ribosome-binding factor A" in subsystem NusA-TFII Cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (123 amino acids)

>GFF221 Ribosome-binding factor A (Variovorax sp. SCN45)
MPKRKAAAPNRAFKVADQIQRDLTELIARELKDPRVGMVTIQAVEVTPDYAHAKVFFSML
TGDVTETTEALNQAAGFLRNGLFKRLHIHTVPTLHFLFDRTTERAADMNALIAQAVASRS
KDD