Protein Info for GFF2201 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Phosphoglycolate phosphatase (EC 3.1.3.18)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 PF00702: Hydrolase" amino acids 5 to 189 (185 residues), 91.7 bits, see alignment E=1.7e-29 PF12710: HAD" amino acids 7 to 186 (180 residues), 40.5 bits, see alignment E=8.1e-14 PF13419: HAD_2" amino acids 8 to 194 (187 residues), 118.5 bits, see alignment E=7.1e-38 TIGR01449: phosphoglycolate phosphatase, bacterial" amino acids 8 to 221 (214 residues), 170.3 bits, see alignment E=8.7e-54 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 76 to 192 (117 residues), 40.7 bits, see alignment E=5.3e-14 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 96 to 189 (94 residues), 34 bits, see alignment E=7.5e-12 PF13242: Hydrolase_like" amino acids 152 to 219 (68 residues), 35 bits, see alignment E=2.2e-12

Best Hits

KEGG orthology group: K01091, phosphoglycolate phosphatase [EC: 3.1.3.18] (inferred from 78% identity to pna:Pnap_1985)

Predicted SEED Role

"Phosphoglycolate phosphatase (EC 3.1.3.18)" in subsystem 2-phosphoglycolate salvage or Glycolate, glyoxylate interconversions or Photorespiration (oxidative C2 cycle) (EC 3.1.3.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.18

Use Curated BLAST to search for 3.1.3.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (222 amino acids)

>GFF2201 Phosphoglycolate phosphatase (EC 3.1.3.18) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSAVDLAMFDLDGTLVATAGEIGDAVNDTLVRFDLPAVSQVQVERWIGHGTRELLIQALA
SAGKTGVDVVRASSALPLIAAEFDRHYQRRCGTRSQLYPQVRETLTALRERGVKLAVVTN
KESRYTATVMDAHRLAPLFHRVISGDTLPTKKPDPAGIHSCLALFQVPPERALFVGDSSI
DVATARNAGVRVWALPYGYNMGEPITACAPDRVIDNLSALLH