Protein Info for GFF2197 in Variovorax sp. SCN45

Annotation: Type I secretion system ATPase, LssB family LapB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 605 transmembrane" amino acids 42 to 63 (22 residues), see Phobius details amino acids 75 to 92 (18 residues), see Phobius details amino acids 163 to 195 (33 residues), see Phobius details amino acids 265 to 285 (21 residues), see Phobius details amino acids 291 to 308 (18 residues), see Phobius details PF00664: ABC_membrane" amino acids 54 to 302 (249 residues), 61.2 bits, see alignment E=2e-20 PF00005: ABC_tran" amino acids 370 to 519 (150 residues), 91 bits, see alignment E=1.6e-29 PF13304: AAA_21" amino acids 491 to 552 (62 residues), 31.6 bits, see alignment E=2.6e-11

Best Hits

KEGG orthology group: None (inferred from 90% identity to vpe:Varpa_5164)

Predicted SEED Role

"cyclolysin secretion ATP-binding protein" in subsystem cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (605 amino acids)

>GFF2197 Type I secretion system ATPase, LssB family LapB (Variovorax sp. SCN45)
MIKFLLPSQLVADTPDEPGASPYAGALHEAFRAAYPLVKGAAWRSLPISLFGLLPSIFLL
QVYDRVLSRSGTSTLAALVSGIFFFLCIEFWLRTRRSRLLRNAGAIIDHGVSGALLNSML
ARPLRALESRPASSWQLYFRDVGSVRGTVTGGLAQSIFDLPMAIFALIVIGIVALPVLPV
VAVFLAIMSFLAWWWADEVRTGRVEEVQRGRGLDRVTSEICHARETLKTQANDGPTIEMW
RQTYNAWLTESFSKNGQIETARDGTTVLLTVFSVIVVTVGAVSVMEQWMTVGGLVASNML
ALKALQPVAGLVSNWRSLATAKEAAKRLETVLREPVEKPPTGMELPQPLGRVTLRDVSFS
FTQNAQQPVLENVDLDIGPGGLHVIVGRNGAGKSTLVKLVSGLYTPTRGTVNIGEYDLSQ
FGREELSRWISYLSQEVYWFGGALVDVMRRGAPGQSDEQIVAACKLSGAHDFISRLPDGY
RTVVGEGGTGFSVGERRKLALAMSFLRKPSVLVLDEPSNDLDFQSERNLLATMLAVAKVR
TVVVVTHSLRIVSAATVVYHVTGQGNVEQGSAAVMVPKLFGVKKPLVAVGDSEDSAGAAA
TRSMA