Protein Info for PS417_11195 in Pseudomonas simiae WCS417

Annotation: NAD(P)H-quinone oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 TIGR02824: putative NAD(P)H quinone oxidoreductase, PIG3 family" amino acids 7 to 331 (325 residues), 478.5 bits, see alignment E=4.4e-148 PF08240: ADH_N" amino acids 32 to 116 (85 residues), 64.3 bits, see alignment E=1.7e-21 PF00107: ADH_zinc_N" amino acids 157 to 282 (126 residues), 77.4 bits, see alignment E=1.5e-25 PF13602: ADH_zinc_N_2" amino acids 190 to 329 (140 residues), 75 bits, see alignment E=1.7e-24

Best Hits

Swiss-Prot: 32% identical to QOR_CAVPO: Quinone oxidoreductase (CRYZ) from Cavia porcellus

KEGG orthology group: None (inferred from 98% identity to pfs:PFLU2403)

Predicted SEED Role

"Quinone oxidoreductase (EC 1.6.5.5)" in subsystem ZZ gjo need homes (EC 1.6.5.5)

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.5

Use Curated BLAST to search for 1.6.5.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UJV3 at UniProt or InterPro

Protein Sequence (332 amino acids)

>PS417_11195 NAD(P)H-quinone oxidoreductase (Pseudomonas simiae WCS417)
MTLPQEMTLIEITTPGGPEVLQPRHAEVPVAGPGEILIRVHAAGVNRPDALQRAGKYPMK
PGFSPIPGLEVAGEVVALGEGVSEYQLGDKVCALTNGGGYAQFCSVPASQALPIPEGMDW
IQAAAVPETFFTVWANLFGLGDAHTGQRVLIHGGTSGIGTTALMLCREFGIQAFATAGSA
DKCAAIAKLGAEPINYREQDFADVIAQQTDNQGVDVILDIMGASYFNNNLKALAMDGHLV
MLGFLGGGKANDVDLLSILAKRAVITGSLLRARSKDEKAAIAEQLREYIWPVLAAGRCLP
IIDKVYAYTDAAQAHARMEGGDHIGKIVLRVE