Protein Info for GFF2194 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Ribulose bisphosphate carboxylase small chain (EC 4.1.1.39)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 64% identical to RBSP_CUPNH: Ribulose bisphosphate carboxylase small chain, plasmid (cbxSP) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K01602, ribulose-bisphosphate carboxylase small chain [EC: 4.1.1.39] (inferred from 81% identity to mpt:Mpe_A1479)

Predicted SEED Role

"Ribulose bisphosphate carboxylase small chain (EC 4.1.1.39)" in subsystem CO2 uptake, carboxysome or Calvin-Benson cycle or Carboxysome or Photorespiration (oxidative C2 cycle) (EC 4.1.1.39)

MetaCyc Pathways

Rubisco shunt (10/10 steps found)
Calvin-Benson-Bassham cycle (11/13 steps found)
ethene biosynthesis V (engineered) (19/25 steps found)
1-butanol autotrophic biosynthesis (engineered) (20/27 steps found)
photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (19/26 steps found)
oxygenic photosynthesis (12/17 steps found)
nucleoside and nucleotide degradation (archaea) (2/10 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.39

Use Curated BLAST to search for 4.1.1.39

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (149 amino acids)

>GFF2194 Ribulose bisphosphate carboxylase small chain (EC 4.1.1.39) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MMTNATGRITQGQFSFLPDLTDPEITAQIEYGLKRGYAWSVEYTDDPHPRNTYWSMYGNP
MFDLHDAAGVLQELQACRKAFPRHYIRMMAFDSTRNVETIAMSFIVNRPASEPGFMLERQ
EVNGRSLRYTTRGYGAVQPEGERYRDTAA