Protein Info for GFF219 in Variovorax sp. SCN45

Annotation: GTP-binding protein TypA/BipA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 612 PF00009: GTP_EFTU" amino acids 4 to 201 (198 residues), 191.7 bits, see alignment E=2.5e-60 TIGR00231: small GTP-binding protein domain" amino acids 5 to 140 (136 residues), 86.2 bits, see alignment E=2.1e-28 TIGR01394: GTP-binding protein TypA/BipA" amino acids 6 to 604 (599 residues), 906.4 bits, see alignment E=6.8e-277 PF01926: MMR_HSR1" amino acids 9 to 130 (122 residues), 24.2 bits, see alignment E=7.5e-09 PF00679: EFG_C" amino acids 402 to 485 (84 residues), 70.6 bits, see alignment E=2.3e-23 PF21018: BipA_C" amino acids 490 to 598 (109 residues), 147.8 bits, see alignment E=2.3e-47

Best Hits

Swiss-Prot: 58% identical to TYPA_SHIFL: GTP-binding protein TypA/BipA (typA) from Shigella flexneri

KEGG orthology group: K06207, GTP-binding protein (inferred from 97% identity to vap:Vapar_2751)

Predicted SEED Role

"GTP-binding protein TypA/BipA" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (612 amino acids)

>GFF219 GTP-binding protein TypA/BipA (Variovorax sp. SCN45)
MSTKQIRNIAIIAHVDHGKTTMVDQLLRQSGTFADHEKVVDTVMDNNAIEKERGITILAK
NCAVTWQGTHINIVDTPGHADFGGEVERALSMVDGVVLLIDAQEGPMPQTRFVTKKALAL
GLKPILVVNKVDKPGANPDKVVNAAFDLFDKLGATDEQLDFPVVYASGINGWSSLEEGAP
GEQWGPDMSALFDTILKHVPSQKGDPAAPLQLQISALDFSTFVGRIGVGRISQGTLKPMT
DVVVMEGPDGKSIKGRVNQVLTFQGLDRVQATEAGPGEIVLINGIADIGIGVTITDPANP
APLPMLKVDEPTLTMNFCVNTSPLAGREGKFVTSRQIWDRLQKELQHNVALRVNETDEEG
IFEVMGRGELHLTILLENMRREGYEMAVSKPRVVFRTVNGEKHEPIELVTADIEDQHQGG
VMQALGERKGELVNMEPDGRGRVRLEYRIPARGLIGFTNEFLNLTRGSGLISNIFDSYEP
HKGDIGGRKNGVLISMDDGEIFTYALGKLDDRGRMFVRANDPVYEGMIVGIHSRDNDLVV
NATRTKQLTNFRVSGKEDAIKITPPIELTLEYGVEFIEDDELVEITPKSVRLRKRFLKEH
ERKRAGRDTSQG