Protein Info for GFF219 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Deoxycytidine triphosphate deaminase (EC 3.5.4.13)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 188 PF22769: DCD" amino acids 3 to 161 (159 residues), 118.2 bits, see alignment E=1.9e-38 TIGR02274: deoxycytidine triphosphate deaminase" amino acids 4 to 187 (184 residues), 164.1 bits, see alignment E=1.4e-52

Best Hits

Swiss-Prot: 92% identical to DCD_POLSJ: dCTP deaminase (dcd) from Polaromonas sp. (strain JS666 / ATCC BAA-500)

KEGG orthology group: K01494, dCTP deaminase [EC: 3.5.4.13] (inferred from 91% identity to vpe:Varpa_4484)

MetaCyc: 67% identical to dCTP deaminase (Rickettsia prowazekii Madrid E)
dCTP deaminase. [EC: 3.5.4.13]

Predicted SEED Role

"Deoxycytidine triphosphate deaminase (EC 3.5.4.13)" (EC 3.5.4.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (188 amino acids)

>GFF219 Deoxycytidine triphosphate deaminase (EC 3.5.4.13) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSIKSDKWIRRMAEQHGLIEPFEPNQVRAVDGKKVISYGTSSYGYDIRCAPEFKVFTNIH
STVVDPKNFDENSFVDINKDVCVIPPNSFALARTMEYFRIPRNVLTICLGKSTYARCGII
VNVTPFEPEWEGYVTLEFSNTTPLPAKIYAGEGCAQVLFFESDEVCETSYKDRGGKYQGQ
IGVTLPKA