Protein Info for PS417_11140 in Pseudomonas simiae WCS417

Annotation: peptide ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 86 to 110 (25 residues), see Phobius details amino acids 120 to 141 (22 residues), see Phobius details amino acids 147 to 164 (18 residues), see Phobius details amino acids 198 to 216 (19 residues), see Phobius details amino acids 249 to 274 (26 residues), see Phobius details PF00528: BPD_transp_1" amino acids 100 to 284 (185 residues), 98.8 bits, see alignment E=1.7e-32

Best Hits

Swiss-Prot: 41% identical to GSID_SALPA: Glutathione transport system permease protein GsiD (gsiD) from Salmonella paratyphi A (strain ATCC 9150 / SARB42)

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 69% identity to axy:AXYL_03699)

MetaCyc: 37% identical to nickel ABC transporter membrane subunit NikC (Escherichia coli K-12 substr. MG1655)
7.2.2.i [EC: 7.2.2.i]; 7.2.2.- [EC: 7.2.2.i]

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.2.i

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UE26 at UniProt or InterPro

Protein Sequence (284 amino acids)

>PS417_11140 peptide ABC transporter permease (Pseudomonas simiae WCS417)
MSSTIAVPVAAKRRRVWAPANALIGGGLLVVLIALALMGLVWSPFDPLKIDLMSRFQAPS
AAHWLGTDEFGRDVFSRLLIGARTSLWVSLLTVSVAVLAGTLIGMLAGYLRGWTDRVLMM
FNDALLAFPGILMALGIMAIIGASKYGIVLALGIAYTPSVVRVVRGTVLSLRELEYIEAS
RVIGNSELYTMLRHIAPNCLAPLCVLATSMFGWALLSESALSFLGLGVPPPAATWGNMLA
SSRPYIASAPWLGVFPGLFICLTLLAINLFGDALRDRLDPRMRK