Protein Info for GFF218 in Sphingobium sp. HT1-2

Annotation: Transcriptional regulator, ArsR family / Methyltransferase fusion

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 PF12840: HTH_20" amino acids 11 to 60 (50 residues), 45.3 bits, see alignment 3.9e-15 PF01022: HTH_5" amino acids 13 to 58 (46 residues), 48.1 bits, see alignment 4.8e-16 PF12802: MarR_2" amino acids 14 to 62 (49 residues), 27.2 bits, see alignment 2e-09 PF01209: Ubie_methyltran" amino acids 146 to 262 (117 residues), 34.2 bits, see alignment E=9.5e-12 PF05175: MTS" amino acids 146 to 253 (108 residues), 24.2 bits, see alignment E=1.3e-08 PF00891: Methyltransf_2" amino acids 147 to 267 (121 residues), 24.5 bits, see alignment E=8.7e-09 PF13489: Methyltransf_23" amino acids 152 to 290 (139 residues), 51 bits, see alignment E=7.7e-17 PF13847: Methyltransf_31" amino acids 153 to 258 (106 residues), 62.7 bits, see alignment E=1.8e-20 PF08241: Methyltransf_11" amino acids 155 to 251 (97 residues), 76.7 bits, see alignment E=1e-24 PF08242: Methyltransf_12" amino acids 155 to 249 (95 residues), 58.7 bits, see alignment E=4.4e-19 PF13649: Methyltransf_25" amino acids 155 to 247 (93 residues), 65.2 bits, see alignment E=4.1e-21

Best Hits

KEGG orthology group: K03892, ArsR family transcriptional regulator (inferred from 81% identity to sjp:SJA_C1-29170)

Predicted SEED Role

"Transcriptional regulator, ArsR family / Methyltransferase fusion"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (323 amino acids)

>GFF218 Transcriptional regulator, ArsR family / Methyltransferase fusion (Sphingobium sp. HT1-2)
MSGALDIFRALGDPTRLRIVHLLRAMELAVGEVAQVVDQSQPRVSRHIRILVESGLVERR
KEGNWVFLRLGQAVSVQPFITLFDRLQPSAAEAAWQSADLARLAAVRAERARAAEAYFAE
HAEEWDAIRSLHVAEADVEAAMRAMLDGQAIGHLLDIGTGTGRMIELFGPAAAQVTALDR
SPDMLRLARAKLPEDAGDKYALLLGDFAALPIEPASVDTVLLHQVLHYAQAPEQVIAQAA
QVLRPGGRVLIVDFAAHEREELRTRDQHARLGFSDMQIEGWFAQAGLELERVDMLPGQEL
TVQLWLGRQRGADILPIEERISA