Protein Info for PS417_11105 in Pseudomonas simiae WCS417

Annotation: pyridine nucleotide-disulfide oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 PF07992: Pyr_redox_2" amino acids 5 to 292 (288 residues), 228.7 bits, see alignment E=3.1e-71 PF00070: Pyr_redox" amino acids 143 to 213 (71 residues), 60.3 bits, see alignment E=6.7e-20 PF13450: NAD_binding_8" amino acids 146 to 180 (35 residues), 24.2 bits, see alignment 1e-08 PF14759: Reductase_C" amino acids 312 to 397 (86 residues), 40.6 bits, see alignment E=8.9e-14

Best Hits

Swiss-Prot: 42% identical to LIGXD_SPHSK: 5,5'-dehydrodivanillate O-demethylase ferredoxin reductase subunit (ligXd) from Sphingobium sp. (strain NBRC 103272 / SYK-6)

KEGG orthology group: K00529, ferredoxin--NAD+ reductase [EC: 1.18.1.3] (inferred from 90% identity to pfs:PFLU2392)

Predicted SEED Role

"Ferredoxin reductase" in subsystem Anaerobic respiratory reductases

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.18.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UAM1 at UniProt or InterPro

Protein Sequence (399 amino acids)

>PS417_11105 pyridine nucleotide-disulfide oxidoreductase (Pseudomonas simiae WCS417)
MNAPLIIVGAGHAGGRAALTLREEGYTGRLILIGDEPHLPYERPPLSKGLLQGTADLAGY
SLCDRARLAELGIEHIAGNPVTHLQPQQHRLQLADGQWLPYAGLLLATGGRARRLPQEQA
HVLYLRTHDEALALRSALKAGTRLVVVGGGFIGLEVAATARGLGCEVTLLEAGPRLAGRV
LPPVISEALLTLHRQHGVDVRLNMALESIQADAVWLVDGQRLPCDLVVVGIGMQPNIELA
AAAGLEVGQGIRVDSHLRTSAPGIYAAGDVCEFRLGGEYQRQETWRNAEAQGRHAALNLL
GRELPFEALPGFWSDQYDWGVQTVGVITPLMVSRPLASGGMLLFYLDADQRLQGACGWAP
GNSVAKDIKLCERLISAHLSLAPASLADPELSLKHLLRG