Protein Info for GFF2174 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Arsenate reductase (EC 1.20.4.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 119 TIGR00014: arsenate reductase (glutaredoxin)" amino acids 5 to 118 (114 residues), 161.2 bits, see alignment E=6.2e-52 PF03960: ArsC" amino acids 8 to 116 (109 residues), 85.1 bits, see alignment E=1.7e-28

Best Hits

Swiss-Prot: 83% identical to YFGD_ECOLI: Uncharacterized protein YfgD (yfgD) from Escherichia coli (strain K12)

KEGG orthology group: K00537, arsenate reductase [EC: 1.20.4.1] (inferred from 98% identity to ses:SARI_00385)

MetaCyc: 40% identical to arsenate reductase (Escherichia coli)
Arsenate reductase (glutaredoxin). [EC: 1.20.4.1]

Predicted SEED Role

"Arsenate reductase (EC 1.20.4.1)" in subsystem Anaerobic respiratory reductases or Arsenic resistance (EC 1.20.4.1)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.20.4.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (119 amino acids)

>GFF2174 Arsenate reductase (EC 1.20.4.1) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MTDTIKIYHNPRCSKSRDTLNLLKSNGVEPEVVLYLDTPADAATVRELLRMLGMSSAREL
MRQKEDLYKTLHLADSELSEEALIQALVEHPKLMERPIVVANGQARIGRPPEQVLDILG