Protein Info for PS417_11085 in Pseudomonas simiae WCS417

Annotation: ATPase AAA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 654 PF01590: GAF" amino acids 109 to 213 (105 residues), 26.5 bits, see alignment E=2e-09 PF00158: Sigma54_activat" amino acids 341 to 507 (167 residues), 228.4 bits, see alignment E=1.1e-71 PF14532: Sigma54_activ_2" amino acids 342 to 512 (171 residues), 66.7 bits, see alignment E=6.8e-22 PF07728: AAA_5" amino acids 365 to 485 (121 residues), 28.5 bits, see alignment E=3.6e-10 PF02954: HTH_8" amino acids 607 to 643 (37 residues), 36 bits, see alignment 1.2e-12

Best Hits

KEGG orthology group: None (inferred from 96% identity to pfs:PFLU2386)

Predicted SEED Role

"Sigma-54 dependent transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U0P5 at UniProt or InterPro

Protein Sequence (654 amino acids)

>PS417_11085 ATPase AAA (Pseudomonas simiae WCS417)
MSMAFSVQDLDYLTALGPAALNDGPVPALEQAWHDCLAGQVERPAHVRQVIWASWRRSVE
AGIDPADNAYRFVAADTLAATQADHRVLIAAAAQVMHGLLAYNPRGHINLTDADGTTLYF
CGLDITPVGSRLLESVQGTNCTGLALAEDHLVYVLAEENFGIGLRQRRMHCAAAPIKNTQ
GQTVAMLTLTAEPGWFHFHTLGTVQAAAEAVSRQMALHGLLEEQQTVLEVLNEGLVVLDE
RGCIKALNRYARQLFGVGLELIGRPFQQLGRSELSDSMGEAVRDRDCTFHLHNRSQLACL
VSVCPLEQGGVIVSLRENRRIREITRRIIGTQASYTFDTIQGSSRAIQDALHLGRIASRS
DSTTLILGESGTGKELFAQAIHNGSDRCNGPFVAVNCGAIPRDLVQSELFGHVEGAFTGS
ARGGSAGKFELADGGTIFLDEIGDMSFDAQVSLLRVLQEGEITRVGAKNSRQVDVRIIAA
THRNLSQAVAQGAFREDLYYRLNVLNLTVPPLRMRREDIPLLARHFLARCARSLRKSVQG
FSPEAMALLSAYGWPGNVRELENSIERATNLAMGALIEPVDLPLENRQRAPLRAYEPQAA
QDLSSHERHAIVAALTNTGGNIRLAARQLNVSRGGLYNKMSRFGLNAADFRSPL