Protein Info for GFF217 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Cytochrome d ubiquinol oxidase subunit I (EC 1.10.3.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 transmembrane" amino acids 15 to 37 (23 residues), see Phobius details amino acids 53 to 74 (22 residues), see Phobius details amino acids 94 to 115 (22 residues), see Phobius details amino acids 125 to 145 (21 residues), see Phobius details amino acids 185 to 205 (21 residues), see Phobius details amino acids 216 to 234 (19 residues), see Phobius details amino acids 316 to 341 (26 residues), see Phobius details amino acids 358 to 379 (22 residues), see Phobius details amino acids 407 to 429 (23 residues), see Phobius details PF01654: Cyt_bd_oxida_I" amino acids 6 to 434 (429 residues), 533.6 bits, see alignment E=1.4e-164

Best Hits

KEGG orthology group: K00425, cytochrome bd-I oxidase subunit I [EC: 1.10.3.-] (inferred from 67% identity to mpt:Mpe_A2573)

MetaCyc: 49% identical to cyanide insensitive ubiquinol oxidase subunit I (Pseudomonas putida KT2440)
RXN-6883 [EC: 1.10.3.11]

Predicted SEED Role

"Cytochrome d ubiquinol oxidase subunit I (EC 1.10.3.-)" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases (EC 1.10.3.-)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 1.10.3.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (454 amino acids)

>GFF217 Cytochrome d ubiquinol oxidase subunit I (EC 1.10.3.-) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MDALILSRIQFAANISFHILFPTITIAMGWFLLFFRIRYLKTRDPAWEEAYYFWTKVFAL
SFALGVVSGIVMSFQFGTNWPGFMERAGNIAGPLLGYEVLTAFFLEASFLGIMLFGRGRV
SERVHLAATFLVAFGTTMSAFWILSLNSWMQTPAGFEIVDGKFIPVDWFAVVFNPSFPYR
LAHKLLASALTASFLIAGLCAWQLIKGSATGGTHKALRTAIIAASVAMPLQFLAGDMHGL
NTLEHQPAKIAALEGIWHTEKSAPLTLFGIPDEAAGTTHYAVKIPKMASLILAHDMDAEL
KGLNEFPNAHPPVAPIFWAFRVMVGVGSLMLVVAWVSAWLLWRRRRQPRGSMDLPKPALY
VLAGMTFSGWLATLSGWYVTEIGRQPFLVYGHLRTAEVATNLPSPMIATTLAAYLIVYGL
LLITYVGVLKYMAEHPFKHAPEAPHGAELGKAGV