Protein Info for GFF2169 in Variovorax sp. SCN45

Annotation: ABC transporter, permease protein 2 (cluster 4, leucine/isoleucine/valine/benzoate) / ABC transporter, ATP-binding protein 1 (cluster 4, leucine/isoleucine/valine/benzoate)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 596 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 20 to 24 (5 residues), see Phobius details amino acids 31 to 51 (21 residues), see Phobius details amino acids 58 to 77 (20 residues), see Phobius details amino acids 83 to 102 (20 residues), see Phobius details amino acids 109 to 127 (19 residues), see Phobius details amino acids 156 to 176 (21 residues), see Phobius details amino acids 207 to 225 (19 residues), see Phobius details amino acids 231 to 250 (20 residues), see Phobius details amino acids 257 to 276 (20 residues), see Phobius details amino acids 282 to 303 (22 residues), see Phobius details PF02653: BPD_transp_2" amino acids 29 to 292 (264 residues), 126.9 bits, see alignment E=1.7e-40 PF00005: ABC_tran" amino acids 351 to 510 (160 residues), 100.8 bits, see alignment E=2.1e-32 PF12399: BCA_ABC_TP_C" amino acids 560 to 584 (25 residues), 47.7 bits, see alignment (E = 1.8e-16)

Best Hits

KEGG orthology group: K01995, branched-chain amino acid transport system ATP-binding protein K01998, branched-chain amino acid transport system permease protein (inferred from 72% identity to axy:AXYL_06411)

Predicted SEED Role

"Branched-chain amino acid transport ATP-binding protein LivG (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (596 amino acids)

>GFF2169 ABC transporter, permease protein 2 (cluster 4, leucine/isoleucine/valine/benzoate) / ABC transporter, ATP-binding protein 1 (cluster 4, leucine/isoleucine/valine/benzoate) (Variovorax sp. SCN45)
MKRLAHPAGVVAFAAALIAVVSMFGNDYYLRIAFMMCVYYLCAAGMNVLVGYAGQKSLGQ
AGLFAAGAYGVALLTSRTDMDPWLALALAAVISGLCGVLIALPSLRVKGPYLAMVTLAFG
IVVEKLVGEWTDVFGGAQGIYGIRPLTWKGAPLDTTQWVILGIVLCAALHLLLRNLLGGR
FGRALLSLQADEIASSSVGVRVYRAKVMAFVVAAVTCGIAGALVAQQNQYINSDFITFHL
SIFILLLVLFGGAGSMYGPLVGAVLLTLTDALLARWPSAQHFLYGFLLLFALYVMPGGVV
GLFNKWFMKSRHRGEGPGGNGIPGQIGPGGEGELLVVQGVTKSYGGVKPAQDVSFRLQRG
HIHALIGPNGAGKSTMINMLTGVIEPDAGVIRFLGQNIVGQPAHTICCLGMGRTFQNLRL
FADLSVLDNVMLGRHSRMSNGFLSSLVAWPTAGKQERATRERALQLLDLVDLGHLAHWPA
GSLPYGLQRRVELARALATEPQLLLLDEPAAGLNPQETAELGELLLRIGKCGVSILMVEH
HMDLVMSISDHVIVLDYGIKIAEGKPAEVQANPRVVEAYLGVDDEEEEALATAMPA