Protein Info for PS417_11060 in Pseudomonas simiae WCS417

Annotation: transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 57 to 77 (21 residues), see Phobius details amino acids 88 to 108 (21 residues), see Phobius details amino acids 114 to 136 (23 residues), see Phobius details amino acids 147 to 168 (22 residues), see Phobius details amino acids 175 to 197 (23 residues), see Phobius details amino acids 217 to 240 (24 residues), see Phobius details amino acids 256 to 279 (24 residues), see Phobius details amino acids 286 to 305 (20 residues), see Phobius details amino acids 311 to 332 (22 residues), see Phobius details amino acids 344 to 366 (23 residues), see Phobius details amino acids 371 to 391 (21 residues), see Phobius details PF07690: MFS_1" amino acids 27 to 358 (332 residues), 108.4 bits, see alignment E=1.9e-35

Best Hits

KEGG orthology group: None (inferred from 94% identity to pfs:PFLU2381)

Predicted SEED Role

"major facilitator superfamily MFS_1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U2L9 at UniProt or InterPro

Protein Sequence (407 amino acids)

>PS417_11060 transporter (Pseudomonas simiae WCS417)
MNDCVAQASVRSQAEPATPAWMAVFSLAMGVFGLLTAEYLPASLLTPMAVDLGVSEALAG
QAVTVTAVVALFAGLLVPGLTRGIDRRVVLLGFSLLMIASNLLVAFSSSLAVLLLMRILL
GVALGGFWSMAAAVAMRLVPAALLPRALSIIFSGIAVGTVVAVPLGSYLGGMYGWRSAFV
AAAAVGGVTLAFQLFTLPRLAPTGTARLRTVLDVLLRPGIAIGMFGCVLVHTGHFALFTY
IRPFLESTTGVGTEGLALMLLGFGAANFVGTLLAGWMLVRYPLGTLVLMPVLVGLAALAL
VLLPASLPGQALLLALWGMAFGGVPVAWSNWVARAVPDQAESAGGMVVASVQSAIAAGAA
GGGVMFSLSGIGGVFLGAGVLMVLAALLIALRVSVPRSGALGVPLHL