Protein Info for PS417_11045 in Pseudomonas simiae WCS417

Annotation: 3-oxoacyl-ACP reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 PF23441: SDR" amino acids 12 to 207 (196 residues), 50.4 bits, see alignment E=5.4e-17 PF00106: adh_short" amino acids 14 to 199 (186 residues), 169.3 bits, see alignment E=1.9e-53 PF08659: KR" amino acids 15 to 177 (163 residues), 50.7 bits, see alignment E=5.4e-17 PF01370: Epimerase" amino acids 16 to 115 (100 residues), 22.4 bits, see alignment E=1.8e-08 PF13561: adh_short_C2" amino acids 22 to 254 (233 residues), 192.9 bits, see alignment E=1.7e-60

Best Hits

Swiss-Prot: 43% identical to XDH_CAUVN: D-xylose 1-dehydrogenase (xylB) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: None (inferred from 98% identity to pfs:PFLU2376)

Predicted SEED Role

"Putative oxidoreductase in arabinose utilization cluster" in subsystem L-Arabinose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UJS3 at UniProt or InterPro

Protein Sequence (255 amino acids)

>PS417_11045 3-oxoacyl-ACP reductase (Pseudomonas simiae WCS417)
MNTQHAVYPDLEGKTVLISGGASGIGEFMVRAFAAQGAKVGFVDRAQSQGERLAALLSSR
GHTVEFVNCDITDEIAYKAAIGRFEHSLGPISVLVNNAANDARHTLEEVDSEMFDRLIAV
NLKHAFFAAKAVVPMMKSAGGGAIINLGSVGWMMASAGYPVYAASKAAAHGMTRALAREL
GPSRIRVNTLVPGWVMTEKQLAMWVDDAAKELISRSQCLPGSVLPEHIANMALFLASDAS
AMCSAQNFIVDGGWV