Protein Info for PS417_11040 in Pseudomonas simiae WCS417

Annotation: aldose epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF01263: Aldose_epim" amino acids 45 to 378 (334 residues), 323.9 bits, see alignment E=5.5e-101

Best Hits

Swiss-Prot: 45% identical to GALM_ACICA: Aldose 1-epimerase (mro) from Acinetobacter calcoaceticus

KEGG orthology group: K01785, aldose 1-epimerase [EC: 5.1.3.3] (inferred from 96% identity to pfs:PFLU2375)

MetaCyc: 45% identical to mutarotase (Acinetobacter calcoaceticus)
Aldose 1-epimerase. [EC: 5.1.3.3]

Predicted SEED Role

"L-arabinose-specific 1-epimerase (mutarotase)" in subsystem L-Arabinose utilization

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See U1S6B9 at UniProt or InterPro

Protein Sequence (382 amino acids)

>PS417_11040 aldose epimerase (Pseudomonas simiae WCS417)
MKHPRYLLSGLALSMLVASGGAQAAGLTSEHKPFGKTNDGTAVEQYVLRNSHGMQATVIT
YGGVLQSLKVPDKHGKVEDVVLGFDDVQGYQSGTAFFGATIGRFGNRLAGGAFELDGKRY
QVPLNDGPNSLHGGAQGFDKHVWKATPVKAKDSVGVTLTYLSKDGEMGFPGNLKTEVTYR
LNDNNELHIDYTATTDKPTVLNLTNHSYFNLAGAGNGDILKQVATLHASHYTPVNATLIP
TGELAPVKGTPMDFLKPTPIGQHIKDDHPQLKFAEPKQGGFDFNWALDTKGDVKQLAAEV
HDPESGRRLQLFTTEPGVQFYTSNFLDGSVKGKAGKTYLHWSGFTLETQHFPDAPNQPKF
ASTRLNPGQTYTQNTVFKFSAD