Protein Info for GFF2163 in Xanthobacter sp. DMC5

Annotation: Toluene efflux pump outer membrane protein TtgI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 526 transmembrane" amino acids 25 to 46 (22 residues), see Phobius details TIGR01845: efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family" amino acids 36 to 490 (455 residues), 401 bits, see alignment E=3.6e-124 PF02321: OEP" amino acids 91 to 278 (188 residues), 111.6 bits, see alignment E=2e-36 amino acids 307 to 489 (183 residues), 121 bits, see alignment E=2.5e-39

Best Hits

KEGG orthology group: None (inferred from 72% identity to xau:Xaut_2451)

Predicted SEED Role

"RND efflux system, outer membrane lipoprotein CmeC" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (526 amino acids)

>GFF2163 Toluene efflux pump outer membrane protein TtgI (Xanthobacter sp. DMC5)
VHRSDGQSGPATPSPAGGSPRRPLRAAVGCLALGVLTALSLSACAVGPEYDTPAMTLPGH
WGPTAKRAEPAPKLKAWWRRMGDPMLDALMAEAVAGNLDVATAKANVRAARASYRQQVGT
LFPQVTGNASGTRGDSGGGVSPNGDITVSNGYGQYQAGLDASWEIDLFGANRRGVEAAAY
NVDAVVNDLDAALLTLVGDVASYYADVRGYQAQIALARRTAASQKETEALTRRKLDAGAA
SAVDLANASGLVASTEANIPELEASLAAAIHRISVLTGQPPAALMLRLSRVKPIPTPRLP
VPRGIPADVLTNRPDVRAAERQLGQSTALIGQAEANRYPSISITGNIDTTGSQLGNLGRA
SSISWAFGPTLTVPIFTGGQLKALVDVAEANRDVSFIAYRASVLTALEDVENASVSLSQQ
RLKTGKLTIAVTSYGEAARLSRTLYENGSTSFLDVLTAERSLYSAQTQLIQSRVATTKYY
IALNKALGGGWDGVVDTSKPEVVDQNTGPHFARIVPPASSDGSARP