Protein Info for GFF2162 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 737 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 125 to 152 (28 residues), see Phobius details amino acids 164 to 187 (24 residues), see Phobius details amino acids 278 to 300 (23 residues), see Phobius details PF03929: PepSY_TM" amino acids 13 to 302 (290 residues), 73.6 bits, see alignment E=3.8e-24 PF00258: Flavodoxin_1" amino acids 321 to 443 (123 residues), 66.8 bits, see alignment E=3.6e-22 PF00175: NAD_binding_1" amino acids 594 to 699 (106 residues), 49.4 bits, see alignment E=1e-16

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (737 amino acids)

>GFF2162 hypothetical protein (Xanthobacter sp. DMC5)
MSFAAVRRTLILLHRWIALILTPIFLVIILTGAVLSFRPIVNSGQGPRPGATLDVAALSQ
LVGAIEKAGQPGGISVIEGGRALQVMAQDPAVAGRWDIASGAHTPASAGGIDIFRTAEGL
HKTLLLGLGIVVEVASFLMLGIMVAGPFLAWLRFRNSLMGWHTAMGWLLLPLTLTSPVTA
VMLSLHIGTGSRPELPRTKRPVAISQALAIAGRDLDLNRLAGARRFRGGTVMLQIAPDAT
GRNGGGFVVTDSGVTPLVGGPSLVKQIHEGTWGGAWSGAINFGISLVLLGLTVTGLWSWV
RRKARNRVRPVAAGGDILVAHASQTGTATRLAGVVFEGLIAGGEKATLAPIGALKPAEIA
RFPLVLLIASTTGEGEVPDGTRALVRQMKSSDLKGVHFAVLALGDRSYTHFCGGGHRLKA
ALLAAGAVEALPLREADRDPSEAFLAWVDTVRSELALNCKIAGLPAVSPPVALTVADRQR
LDVPGTGNTQETWRIWLEGTQDIAFRPGDLVRIAAGAGERPRSYSVGSSSRVDPRRIALT
VRLHEWTADDGERHLGRVSGFLLREAEQGVTVEARLDPHPGFNPPADPKWPIVMIAAGSG
IAPFPGFIAERRASGRAGPAWLIFGNRHRDGDFLWRDVFEEALADGTLTRMDTAFSRDPD
DGARVQDRLREHAPEVFEWLVETKAIVYICGRRAMSDAVLEALAEVLVTEGGLKPEAARA
EIGQWVAEGRVRVDTFN