Protein Info for GFF2159 in Variovorax sp. SCN45

Annotation: Pyrimidine operon regulatory protein PyrR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00156: Pribosyltran
  • amino acids 24 to 133 (110 residues), 53.6 bits, E=8.1e-19

Best Hits

Swiss-Prot: 39% identical to PYRR_PSEU2: Bifunctional protein PyrR (pyrR) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K02825, pyrimidine operon attenuation protein / uracil phosphoribosyltransferase [EC: 2.4.2.9] (inferred from 93% identity to vpe:Varpa_5219)

Predicted SEED Role

"Uracil phosphoribosyltransferase (EC 2.4.2.9) / Pyrimidine operon regulatory protein PyrR" in subsystem De Novo Pyrimidine Synthesis or LMPTP YwlE cluster (EC 2.4.2.9)

MetaCyc Pathways

• superpathway of pyrimidine nucleobases salvage (4/4 steps found)
• superpathway of pyrimidine ribonucleosides salvage (8/10 steps found)
• pyrimidine nucleobases salvage II (2/2 steps found)
• pyrimidine nucleobases salvage I (1/1 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.9

Use Curated BLAST to search for 2.4.2.9

Protein Sequence (165 amino acids)

>GFF2159 Pyrimidine operon regulatory protein PyrR (Variovorax sp. SCN45)
VSSIPDAEALYTKLLAGVKTLMRPETKLVGITSGGAWLVERLQKDLGLPGAPGVISSAMH
RDDFARRGLSASAQTALPFDVNGTDVLLLDDVLYTGRTIRAVLNELFDFGRPACVRLAVL
VDRGGRELPVAADFAATTLTLPATQLLALARADSGAFSLKVEESK