Protein Info for GFF2153 in Methylophilus sp. DMC18

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 78 to 99 (22 residues), see Phobius details amino acids 117 to 138 (22 residues), see Phobius details amino acids 154 to 174 (21 residues), see Phobius details amino acids 184 to 205 (22 residues), see Phobius details PF05552: MS_channel_1st_1" amino acids 11 to 58 (48 residues), 58.3 bits, see alignment 2.9e-20 amino acids 107 to 153 (47 residues), 45.1 bits, see alignment 3.7e-16

Best Hits

KEGG orthology group: None (inferred from 76% identity to mmb:Mmol_0167)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (223 amino acids)

>GFF2153 hypothetical protein (Methylophilus sp. DMC18)
MQYQIEIFLSSLNQFWIELVHFVPKLLAAMVILFFGWLVAKAVRLGVKRILELSHFDTFA
QKSGLEAFMRSANYKVSLSGIISQVVYWLVILLFVITGANSLGLSEVAALLKELASYLPH
IIVAILVVIFGTLFARFINRLVFAWLHSIKFDQALVISTSAEYCIQILAIFIALEQLGIG
MQLIHSLFVIVFGAVFLALAIAFGLGGRDWAAKVIDQAQQKKK