Protein Info for GFF2143 in Sphingobium sp. HT1-2

Annotation: UPF0118 membrane protein SMc00793

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 transmembrane" amino acids 16 to 36 (21 residues), see Phobius details amino acids 42 to 62 (21 residues), see Phobius details amino acids 72 to 95 (24 residues), see Phobius details amino acids 160 to 183 (24 residues), see Phobius details amino acids 195 to 211 (17 residues), see Phobius details amino acids 217 to 239 (23 residues), see Phobius details amino acids 248 to 275 (28 residues), see Phobius details amino acids 281 to 300 (20 residues), see Phobius details amino acids 310 to 329 (20 residues), see Phobius details amino acids 335 to 360 (26 residues), see Phobius details PF01594: AI-2E_transport" amino acids 32 to 349 (318 residues), 156 bits, see alignment E=8.2e-50

Best Hits

KEGG orthology group: None (inferred from 85% identity to sjp:SJA_C1-13030)

Predicted SEED Role

"transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (384 amino acids)

>GFF2143 UPF0118 membrane protein SMc00793 (Sphingobium sp. HT1-2)
VTTNEELEVNRRRDRLLASIALSSGVGLLLALPFALRAGAEFFLPLTAALVIAIALVPLL
EWLERRGLPSGLSALLAVVAFLSVANTALVLIVVPATDWFRILPQRLPKIQATLAPLIDF
YSQAQRFVDETVQMLVAGPASVAHRAAVETPGSLLQFAAASAPSAIIQMVFALLIIYFFL
AGWTRLRRRTINSRGSFDGAMAVARVIQNVVDATSAYVMTIATINLCLGFAVALALWLIG
MPSPWMWGGIVALLNFIPYFGPMLAAVLLALGGLMVFDDVWTALLPAFLQIGFHLVEANV
ITPTILGRRLTMNPLLILVSLTFWGWVWGTPGALLGVPLLIIVQTVVAAAGTPDIAGFLF
EQGTLTVSRRKENATSEETDGEDG