Protein Info for GFF2132 in Sphingobium sp. HT1-2

Annotation: NAD-dependent glyceraldehyde-3-phosphate dehydrogenase (EC 1.2.1.12)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 TIGR01534: glyceraldehyde-3-phosphate dehydrogenase, type I" amino acids 4 to 327 (324 residues), 428.1 bits, see alignment E=1.2e-132 PF00044: Gp_dh_N" amino acids 4 to 105 (102 residues), 122.6 bits, see alignment E=7.3e-40 PF02800: Gp_dh_C" amino acids 158 to 315 (158 residues), 214.7 bits, see alignment E=5.2e-68

Best Hits

Swiss-Prot: 69% identical to G3P_ZYMMO: Glyceraldehyde-3-phosphate dehydrogenase (gap) from Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)

KEGG orthology group: K00134, glyceraldehyde 3-phosphate dehydrogenase [EC: 1.2.1.12] (inferred from 87% identity to sch:Sphch_1195)

MetaCyc: 56% identical to Gap (Thermotoga maritima)
Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating). [EC: 1.2.1.12]

Predicted SEED Role

"NAD-dependent glyceraldehyde-3-phosphate dehydrogenase (EC 1.2.1.12)" in subsystem Calvin-Benson cycle or Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Pyridoxin (Vitamin B6) Biosynthesis or Redox-dependent regulation of nucleus processes (EC 1.2.1.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (336 amino acids)

>GFF2132 NAD-dependent glyceraldehyde-3-phosphate dehydrogenase (EC 1.2.1.12) (Sphingobium sp. HT1-2)
VATKVAINGFGRIGRLVARAILSRTDHDLELVSINDLGDAKANALLFKRDSVHGNWAGEV
SVDGDFLVVDGKKIKVTAERDPANLPHAELGVEIALECTGIFTSKDKAGAHLTAGAKRVV
ISAPGTNVDKTVVFGVNHDELTADDIIISNASCTTNCLAPLAKVLNDSIGIERGFMTTIH
SYTNDQNTLDQIHKDMRRARAAALSMIPTTTGAARAVGEVLPALKGKLDGSSVRVPTPNV
SVVDLKFIPSRATTVEEVNGLLKAASESGPLKGILGYSDEPLVSIDYNGDPRSSTVDSLE
TAVIEGNLVRVLSWYDNEWGFSNRMIDTSGVMAKFL