Protein Info for GFF2131 in Sphingobium sp. HT1-2

Annotation: Phosphoglycerate kinase (EC 2.7.2.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00162: PGK
  • amino acids 9 to 390 (382 residues), 485.8 bits, E=4.8e-150

Best Hits

Swiss-Prot: 77% identical to PGK_SPHWW: Phosphoglycerate kinase (pgk) from Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273)

KEGG orthology group: K00927, phosphoglycerate kinase [EC: 2.7.2.3] (inferred from 92% identity to sch:Sphch_1194)

Predicted SEED Role

"Phosphoglycerate kinase (EC 2.7.2.3)" in subsystem Calvin-Benson cycle or Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 2.7.2.3)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• heterolactic fermentation (16/18 steps found)
• Entner-Doudoroff pathway I (9/9 steps found)
• homolactic fermentation (11/12 steps found)
• Bifidobacterium shunt (13/15 steps found)
• glycolysis III (from glucose) (10/11 steps found)
• superpathway of glucose and xylose degradation (14/17 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (14/17 steps found)
• gluconeogenesis I (11/13 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (15/19 steps found)
• superpathway of anaerobic sucrose degradation (15/19 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (17/22 steps found)
• glycolysis II (from fructose 6-phosphate) (9/11 steps found)
• glycolysis I (from glucose 6-phosphate) (10/13 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• gluconeogenesis III (9/12 steps found)
• glycolysis VI (from fructose) (8/11 steps found)
• glycolysis IV (7/10 steps found)
• Calvin-Benson-Bassham cycle (9/13 steps found)
• superpathway of N-acetylneuraminate degradation (15/22 steps found)
• superpathway of hexitol degradation (bacteria) (12/18 steps found)
• ethene biosynthesis V (engineered) (17/25 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (18/27 steps found)
• glycerol degradation to butanol (10/16 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (17/26 steps found)
• oxygenic photosynthesis (10/17 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Carbon fixation in photosynthetic organisms
• Glycolysis / Gluconeogenesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.3

Protein Sequence (400 amino acids)

>GFF2131 Phosphoglycerate kinase (EC 2.7.2.3) (Sphingobium sp. HT1-2)
MAKPFKTLDDMGDITGKVVLVREDLNVPMQEGSVSDDTRLRAAMPTILELADRGAKVLIL
AHFGRPKGQKNPEFSLSKITRPLTQVLGREVQFIPDCQGEAATDGIKVMRNGDIAILENT
RFHAGEEKNDPALVDAIAAIGDLYVNDAFSAAHRAHASTEGLAHKLPAFAGRSMEKELDA
LEAALGAPVKPVAAVVGGAKVSTKLDVLNNLVTKVDHLIIGGGMANTFLHARGVDVGKSL
CEKDLADTADAIFDKAEDAGCIIHLPYDVVVAKEFAANPPSVRTCNVHEVAEDEMILDVG
PAAVEALGDALKNCRTLVWNGPLGAFEIAPFDAATVALAKTAAALTKEGQLVSVAGGGDT
VAALNHAGAAADFTFISTAGGAFLEWMEGKELPGVKALYA