Protein Info for GFF2126 in Sphingobium sp. HT1-2

Annotation: Thiamin-phosphate pyrophosphorylase (EC 2.5.1.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 TIGR00693: thiamine-phosphate diphosphorylase" amino acids 28 to 214 (187 residues), 180.4 bits, see alignment E=1.2e-57 PF02581: TMP-TENI" amino acids 29 to 207 (179 residues), 196.2 bits, see alignment E=1.6e-62

Best Hits

Swiss-Prot: 63% identical to THIE_ERYLH: Thiamine-phosphate synthase (thiE) from Erythrobacter litoralis (strain HTCC2594)

KEGG orthology group: K00788, thiamine-phosphate pyrophosphorylase [EC: 2.5.1.3] (inferred from 81% identity to sjp:SJA_C1-13150)

Predicted SEED Role

"Thiamin-phosphate pyrophosphorylase (EC 2.5.1.3)" in subsystem Thiamin biosynthesis (EC 2.5.1.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.3

Use Curated BLAST to search for 2.5.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (230 amino acids)

>GFF2126 Thiamin-phosphate pyrophosphorylase (EC 2.5.1.3) (Sphingobium sp. HT1-2)
MTDFTDEELALDPHFAEQFEKGFRPACQLYLISPPAIDETFVDQLAQAFDGGKVAAFQLR
LKGIDDHAIAALAGPIQALCAEREVAFIINDSIGLAKRLNADGVHLGQEDGDPREARKQL
GPKVQIGVTCHDSRHLAMEAGEAGADYVAFGAFYPTTTKETTHRAEPSILGWWTTLFELP
CVAIGGITPDNAAPLIAAGADFLAVSGTVWNHPEGPKAGVAAFASVLGGA