Protein Info for PS417_10805 in Pseudomonas simiae WCS417

Annotation: chemotaxis protein CheY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 741 TIGR00229: PAS domain S-box protein" amino acids 66 to 191 (126 residues), 24.1 bits, see alignment E=1.6e-09 PF13188: PAS_8" amino acids 70 to 132 (63 residues), 24.6 bits, see alignment E=5.3e-09 PF08447: PAS_3" amino acids 228 to 315 (88 residues), 57.1 bits, see alignment E=5.3e-19 PF00512: HisKA" amino acids 371 to 435 (65 residues), 33 bits, see alignment E=1.5e-11 PF02518: HATPase_c" amino acids 479 to 598 (120 residues), 72.1 bits, see alignment E=1.6e-23 PF00072: Response_reg" amino acids 624 to 736 (113 residues), 50.1 bits, see alignment E=8.4e-17

Best Hits

KEGG orthology group: None (inferred from 78% identity to pst:PSPTO_3696)

Predicted SEED Role

"FOG: PAS/PAC domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See U1S6H7 at UniProt or InterPro

Protein Sequence (741 amino acids)

>PS417_10805 chemotaxis protein CheY (Pseudomonas simiae WCS417)
MKNLTRAELEAQVLHLRALLEGAGLDPLSGSPGNGAAQRSVDETQACYRQAVLDLSSMRV
EHTALRQSEERFRTILETVESAFAIVKVKFDADDRPIDYRFVEANPAFEHQAGVDLRGKW
VTEFAPDLEQFWFETYGHVAKTGEPATFESYAEAFKRWFDVRAVRVGDPADRQIAIIFSD
VTERRNAEERLRISEAVARQNVERVQLALAAGAIIGTWHWDIPSDRFSIDEAFARAFGVD
PALGHEGLSLAQVMTSVHPEDREGLTTAIHAAIARGGAYAHQYRVRRDDGRYYWIEANGR
VDLAEDGTPLTLPGVVIDVESRRSVEAERDRATAALRALNETLEQRVAERTVELIQAEEK
LRQSQKMEAVGQLTGGLAHDFNNLLAGISGALELTGLRIAQGRWQEVDKYISTAQGAAKR
AAALTHRLLAFSRRQTLDPRPTDVNVLMEGMGELIQRTVGPSITVDTLGASGVWPTLVDA
SQLENALLNLCINARDAMPHGGRIRIETANVCVDAATASAHDLTEGEYLTLTVSDTGTGM
TPEIMAKAFDPFFTTKPIGQGTGLGLSMIYGFAKQSGGQARIASQVGRGTAISLYLPRYQ
GQAIEADPELDSTSATPAERGETILIVDDEPSVRTLLMDVLGGLDYSLIEASDSITGLKI
LRSDVHIDLLITDVGLPGGMNGRQMADAGREVRPALKTLFITGYAESTIIGDNSLGPGMQ
VLTKPFAIDTLTARVRELIES