Protein Info for GFF2117 in Sphingobium sp. HT1-2

Annotation: NADH-ubiquinone oxidoreductase chain C (EC 1.6.5.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 TIGR01961: NADH (or F420H2) dehydrogenase, subunit C" amino acids 39 to 156 (118 residues), 140.3 bits, see alignment E=2.2e-45 PF00329: Complex1_30kDa" amino acids 39 to 157 (119 residues), 149.8 bits, see alignment E=2.7e-48

Best Hits

KEGG orthology group: K00332, NADH dehydrogenase I subunit C [EC: 1.6.5.3] (inferred from 76% identity to sch:Sphch_1184)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain C (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (262 amino acids)

>GFF2117 NADH-ubiquinone oxidoreductase chain C (EC 1.6.5.3) (Sphingobium sp. HT1-2)
MGHSAPKIVNPEGIAEEIGALLGSMLIETIDHADELTFVVARDDLANAMVALRDMAHYQQ
LMEIAGVDYPERPDRFEVAYHLLSVTRNHRVRVKVSTDEDTPVPTVTHLWPVAGWLEREV
FDMYGVIFDGNTDLRRILTDYGFKGHPQRKDFPLTGYVELRYSEEDKRVVYEPVKLAQDF
RSFDFMSPWEGAQYVLPGDEKAAAPAAAPAAAPTPKATESKADTGAGDAANKKAEEKSAD
APAKPAAETDEGKGAAKPEGKA