Protein Info for PS417_10790 in Pseudomonas simiae WCS417

Annotation: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 186 transmembrane" amino acids 7 to 24 (18 residues), see Phobius details amino acids 30 to 50 (21 residues), see Phobius details amino acids 62 to 81 (20 residues), see Phobius details amino acids 87 to 106 (20 residues), see Phobius details amino acids 127 to 143 (17 residues), see Phobius details amino acids 148 to 171 (24 residues), see Phobius details TIGR00560: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase" amino acids 1 to 179 (179 residues), 189.3 bits, see alignment E=4.5e-60 PF01066: CDP-OH_P_transf" amino acids 1 to 165 (165 residues), 132.1 bits, see alignment E=1.2e-42

Best Hits

Swiss-Prot: 59% identical to PGSA_YERPP: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (pgsA) from Yersinia pestis (strain Pestoides F)

KEGG orthology group: K00995, CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase [EC: 2.7.8.5] (inferred from 98% identity to pfs:PFLU2191)

MetaCyc: 61% identical to CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (Escherichia coli K-12 substr. MG1655)
CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase. [EC: 2.7.8.5]

Predicted SEED Role

"CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.5

Use Curated BLAST to search for 2.7.8.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TWQ5 at UniProt or InterPro

Protein Sequence (186 amino acids)

>PS417_10790 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (Pseudomonas simiae WCS417)
MNIPNLITVLRVLLIPIFILLFYLPYEWSYAASSSVFAFAAATDWLDGYLARRLEQSTPF
GAFLDPVADKLMVAVALVLLVQEHGNLWLTLPAAVIIGREIVVSALREWMAEIGARAHVA
VSNMGKWKTAAQMLALVILLANPSHFTFWVLLGYALLLVAAGLTLWSMLQYLRAAWPHLR
TTVEKK