Protein Info for GFF2112 in Sphingobium sp. HT1-2

Annotation: NADH-ubiquinone oxidoreductase chain H (EC 1.6.5.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 transmembrane" amino acids 15 to 41 (27 residues), see Phobius details amino acids 88 to 110 (23 residues), see Phobius details amino acids 121 to 142 (22 residues), see Phobius details amino acids 162 to 184 (23 residues), see Phobius details amino acids 200 to 218 (19 residues), see Phobius details amino acids 247 to 271 (25 residues), see Phobius details amino acids 282 to 304 (23 residues), see Phobius details amino acids 324 to 344 (21 residues), see Phobius details PF00146: NADHdh" amino acids 23 to 336 (314 residues), 394 bits, see alignment E=2.3e-122

Best Hits

Swiss-Prot: 83% identical to NUOH_SPHWW: NADH-quinone oxidoreductase subunit H (nuoH) from Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273)

KEGG orthology group: K00337, NADH dehydrogenase I subunit H [EC: 1.6.5.3] (inferred from 93% identity to sch:Sphch_1179)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain H (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (349 amino acids)

>GFF2112 NADH-ubiquinone oxidoreductase chain H (EC 1.6.5.3) (Sphingobium sp. HT1-2)
VTAFFQGLGLPFEGAWLLSTIIGILVIALPLMLAVAMIIYADRKIWAAMALRRGPNVVGP
LGLLQSFADGLKVFLQETIVPSASNKALFLIAPIITFTVALMAWAVIPFGVGVMVSNVNV
GLLYILAISSLGVYGVVLAGWASNSKYPFYSAIRASAQMISYEVSIGFILITVVLWAGSF
NMSAIVESQKGYYGFLNGNGFNPLLFPMAIMFLISAMAETARAPFDLTEAESELVAGYQT
EYSSMAFALFWLGEYANVILMCGLNAILFWGGYLPPFDWAPLYMVPGIIWFLLKIAFFFF
VFSWVKATVPRYRYDQLMRLGWKIFLPTSLFFVFLVSGFLMLTRYGGAQ