Protein Info for GFF2111 in Variovorax sp. SCN45

Annotation: Permease of the drug/metabolite transporter (DMT) superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 40 to 57 (18 residues), see Phobius details amino acids 69 to 90 (22 residues), see Phobius details amino acids 97 to 116 (20 residues), see Phobius details amino acids 124 to 142 (19 residues), see Phobius details amino acids 155 to 176 (22 residues), see Phobius details amino acids 184 to 204 (21 residues), see Phobius details amino acids 215 to 236 (22 residues), see Phobius details amino acids 245 to 265 (21 residues), see Phobius details amino acids 272 to 292 (21 residues), see Phobius details PF00892: EamA" amino acids 8 to 140 (133 residues), 45.9 bits, see alignment E=3.7e-16 amino acids 153 to 287 (135 residues), 42.5 bits, see alignment E=4.1e-15

Best Hits

KEGG orthology group: None (inferred from 47% identity to vap:Vapar_3151)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (301 amino acids)

>GFF2111 Permease of the drug/metabolite transporter (DMT) superfamily (Variovorax sp. SCN45)
MDKKNLRTGVLAALAAALIGSAWQLASRHGVTTTLGPMELVLLRYGIPALLLAPLWLGKG
LIPPKAPRLALVLLVIGGGLPFGLLVLAGARWAPASHMGILMASSLPLFTAIGAWLHKRQ
KVGGIRLLGLGCIAAGIALFAAESFRGGSLDWRGNLLFLAAAVLWTVHSLAFAHCGFTPW
QGAAFVNGWSSLLLLPLLVTVGAPRLLTAPWTDVALQAAMQGVVAGLLGLVAYLLAVERL
GAARASLSAALVPVLTTLGAAAWMNEPITNEVLLALSLVVPGIVLASGAVRWPARAMRPR
S