Protein Info for GFF2110 in Hydrogenophaga sp. GW460-11-11-14-LB1
Annotation: 3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 51% identical to HCD2_BOVIN: 3-hydroxyacyl-CoA dehydrogenase type-2 (HSD17B10) from Bos taurus
KEGG orthology group: None (inferred from 80% identity to vpe:Varpa_5267)MetaCyc: 51% identical to 3-hydroxy-2-methylbutyryl-CoA dehydrogenase subunit (Homo sapiens)
3-hydroxyacyl-CoA dehydrogenase. [EC: 1.1.1.35]; 3-alpha-(17-beta)-hydroxysteroid dehydrogenase (NAD(+)). [EC: 1.1.1.35, 1.1.1.239]; 3-hydroxy-2-methylbutyryl-CoA dehydrogenase. [EC: 1.1.1.35, 1.1.1.239, 1.1.1.178]; 1.1.1.178 [EC: 1.1.1.35, 1.1.1.239, 1.1.1.178]
Predicted SEED Role
"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)
MetaCyc Pathways
- superpathway of fatty acids biosynthesis (E. coli) (48/53 steps found)
- superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
- palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
- oleate β-oxidation (29/35 steps found)
- oleate biosynthesis IV (anaerobic) (13/14 steps found)
- superpathway of unsaturated fatty acids biosynthesis (E. coli) (17/20 steps found)
- superpathway of fatty acid biosynthesis I (E. coli) (14/16 steps found)
- biotin biosynthesis I (13/15 steps found)
- palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (8/9 steps found)
- phenylacetate degradation I (aerobic) (8/9 steps found)
- adipate degradation (5/5 steps found)
- fatty acid elongation -- saturated (5/5 steps found)
- gondoate biosynthesis (anaerobic) (4/4 steps found)
- 8-amino-7-oxononanoate biosynthesis I (9/11 steps found)
- superpathway of phenylethylamine degradation (9/11 steps found)
- benzoyl-CoA degradation I (aerobic) (6/7 steps found)
- 2-methyl-branched fatty acid β-oxidation (11/14 steps found)
- superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
- benzoyl-CoA biosynthesis (3/3 steps found)
- (5Z)-dodecenoate biosynthesis I (5/6 steps found)
- fatty acid salvage (5/6 steps found)
- stearate biosynthesis II (bacteria and plants) (5/6 steps found)
- 1-butanol autotrophic biosynthesis (engineered) (20/27 steps found)
- anteiso-branched-chain fatty acid biosynthesis (25/34 steps found)
- even iso-branched-chain fatty acid biosynthesis (25/34 steps found)
- odd iso-branched-chain fatty acid biosynthesis (25/34 steps found)
- valproate β-oxidation (7/9 steps found)
- 4-hydroxybenzoate biosynthesis III (plants) (4/5 steps found)
- 8-amino-7-oxononanoate biosynthesis IV (4/5 steps found)
- cis-vaccenate biosynthesis (4/5 steps found)
- adipate biosynthesis (4/5 steps found)
- octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (9/12 steps found)
- photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (19/26 steps found)
- palmitate biosynthesis III (21/29 steps found)
- fatty acid β-oxidation I (generic) (5/7 steps found)
- (5Z)-dodecenoate biosynthesis II (4/6 steps found)
- L-isoleucine degradation I (4/6 steps found)
- pyruvate fermentation to butanol II (engineered) (4/6 steps found)
- stearate biosynthesis IV (4/6 steps found)
- superpathway of Clostridium acetobutylicum acidogenic fermentation (6/9 steps found)
- (R)- and (S)-3-hydroxybutanoate biosynthesis (engineered) (3/5 steps found)
- fatty acid β-oxidation II (plant peroxisome) (3/5 steps found)
- glutaryl-CoA degradation (3/5 steps found)
- pyruvate fermentation to hexanol (engineered) (7/11 steps found)
- tetradecanoate biosynthesis (mitochondria) (17/25 steps found)
- pyruvate fermentation to butanoate (4/7 steps found)
- methyl ketone biosynthesis (engineered) (3/6 steps found)
- propanoate fermentation to 2-methylbutanoate (3/6 steps found)
- glycerol degradation to butanol (10/16 steps found)
- 3-hydroxypropanoate/4-hydroxybutanate cycle (11/18 steps found)
- fatty acid β-oxidation VI (mammalian peroxisome) (3/7 steps found)
- 3-phenylpropanoate degradation (5/10 steps found)
- L-glutamate degradation V (via hydroxyglutarate) (5/10 steps found)
- petroselinate biosynthesis (2/6 steps found)
- benzoate biosynthesis I (CoA-dependent, β-oxidative) (4/9 steps found)
- pyruvate fermentation to butanol I (3/8 steps found)
- L-glutamate degradation VII (to butanoate) (5/12 steps found)
- 2-allylmalonyl-CoA biosynthesis (2/8 steps found)
- 2-methylpropene degradation (2/8 steps found)
- L-tryptophan degradation III (eukaryotic) (7/15 steps found)
- streptorubin B biosynthesis (20/34 steps found)
- methyl tert-butyl ether degradation (2/10 steps found)
- superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (7/17 steps found)
- superpathway of Clostridium acetobutylicum solventogenic fermentation (4/13 steps found)
- benzoate fermentation (to acetate and cyclohexane carboxylate) (6/17 steps found)
- crotonate fermentation (to acetate and cyclohexane carboxylate) (5/16 steps found)
- toluene degradation VI (anaerobic) (4/18 steps found)
- cholesterol degradation to androstenedione I (cholesterol oxidase) (2/17 steps found)
- androstenedione degradation I (aerobic) (6/25 steps found)
- platensimycin biosynthesis (6/26 steps found)
- cholesterol degradation to androstenedione II (cholesterol dehydrogenase) (3/22 steps found)
- superpathway of testosterone and androsterone degradation (6/28 steps found)
- androstenedione degradation II (anaerobic) (4/27 steps found)
- superpathway of cholesterol degradation I (cholesterol oxidase) (8/42 steps found)
- superpathway of cholesterol degradation II (cholesterol dehydrogenase) (9/47 steps found)
- superpathway of cholesterol degradation III (oxidase) (5/49 steps found)
- mycolate biosynthesis (26/205 steps found)
- superpathway of mycolate biosynthesis (27/239 steps found)
KEGG Metabolic Maps
- Androgen and estrogen metabolism
- Benzoate degradation via CoA ligation
- Bile acid biosynthesis
- Biosynthesis of plant hormones
- Biosynthesis of unsaturated fatty acids
- Butanoate metabolism
- C21-Steroid hormone metabolism
- Caprolactam degradation
- Fatty acid biosynthesis
- Fatty acid elongation in mitochondria
- Fatty acid metabolism
- Geraniol degradation
- Lysine degradation
- Tryptophan metabolism
- Valine, leucine and isoleucine degradation
Isozymes
Compare fitness of predicted isozymes for: 1.1.1.100, 1.1.1.35
Use Curated BLAST to search for 1.1.1.100 or 1.1.1.178 or 1.1.1.239 or 1.1.1.35
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (260 amino acids)
>GFF2110 3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100) (Hydrogenophaga sp. GW460-11-11-14-LB1) MQLGTDIAAVVTGGASGLGAATARRLAAQGVKVALFDLNVEQGEALAKEIGGVFCRVNVT SEEDVDQGFERARQAHGQERILVNCAGTGNAVKTASFDKATGKPRHFPLADFEKIIQINL IGTFRCITRSAAGMLGLAPLADGERGAIVNTASVAAQDGQVGQAAYAASKAGVVGLTLPV ARDLMGDGIRVNTILPGIFDTPLLQAAPDNVKAALAASVPFPKRLGRPEEFAAVAEMLIT TGYVNGEAIRVDGAIRMAPR