Protein Info for GFF2110 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Sigma factor RpoE regulatory protein RseC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04246: RseC_MucC
  • amino acids 8 to 139 (132 residues), 113 bits, E=4.7e-37

Best Hits

Swiss-Prot: 82% identical to RSEC_ECOLI: Protein RseC (rseC) from Escherichia coli (strain K12)

KEGG orthology group: K03803, sigma-E factor negative regulatory protein RseC (inferred from 98% identity to spq:SPAB_00340)

Predicted SEED Role

"Sigma factor RpoE regulatory protein RseC" in subsystem Transcription initiation, bacterial sigma factors

Protein Sequence (159 amino acids)

>GFF2110 Sigma factor RpoE regulatory protein RseC (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MIKEWATVVSWQNGQAVVSCDVKASCSSCASRAGCGSRVLNKLGPQTTHTIVVPSAEPLA
PGQKVELGIAEKSLLGSALLVYMSPLAGLFLCAALFQMLFGSDLAALSGAVLGGVGGFLV
ARGYSRKLAERDAWQPVILNVALPPDLVRVETTSIETRQ