Protein Info for PS417_10725 in Pseudomonas simiae WCS417

Annotation: excinuclease ABC subunit C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 607 TIGR00194: excinuclease ABC subunit C" amino acids 11 to 585 (575 residues), 613.3 bits, see alignment E=2.5e-188 PF01541: GIY-YIG" amino acids 18 to 93 (76 residues), 37.8 bits, see alignment E=5.6e-13 PF02151: UVR" amino acids 207 to 237 (31 residues), 36.4 bits, see alignment (E = 9.8e-13) PF22920: UvrC_RNaseH" amino acids 250 to 366 (117 residues), 100.5 bits, see alignment E=1.7e-32 PF08459: UvrC_RNaseH_dom" amino acids 383 to 538 (156 residues), 188 bits, see alignment E=3.3e-59 PF14520: HHH_5" amino acids 553 to 603 (51 residues), 39.3 bits, see alignment 2.3e-13

Best Hits

Swiss-Prot: 99% identical to UVRC_PSEFS: UvrABC system protein C (uvrC) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K03703, excinuclease ABC subunit C (inferred from 99% identity to pfs:PFLU2190)

Predicted SEED Role

"Excinuclease ABC subunit C" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UDU6 at UniProt or InterPro

Protein Sequence (607 amino acids)

>PS417_10725 excinuclease ABC subunit C (Pseudomonas simiae WCS417)
MSTPFDPSAFLSTCSGRPGVYRMFDSEARLLYVGKAKNLKNRLASYFRKSGLAPKTAALV
ARIAQVETTITANETEALLLEQTLIKEWRPPYNILLRDDKSYPYVFLSDGNFPRLSIHRG
AKKQKGKYFGPYPSAGAIRESLSLLQKTFFVRQCEDSFYKNRTRPCLQYQIKRCKAPCVG
LVEPAEYAEDVRHSVMFLEGRSNALTDELSGAMEQAASTLDFERAAELRDQISLLRRVQD
QQSMEGGTGDVDVIAAFVNPGGACVHLISVRGGRVLGSKNFFPQTGIDEDVAEVMAAFLG
QYYVSSPERDLPSELIVNVVHEDFPTLIEAIHELRGRELDISHRVRGTRARWQQLAVTNA
EQALSARLANRQHVAARFDALAEVLNLDEPPQRLECYDISHSSGEATVASCVVFGPEGPI
KSDYRRYNIEGVTAGDDYAAMHQALTRRFSKLKDGEGKLPDILLVDGGKGQLSMARDVLN
ELAVPDLILLGVAKGATRKAGFETLYLNDAAHEFTLKGDSPALHLIQQIRDEAHRFAITG
HRARRGKTRRTSTLEGVAGVGPTRRRDLLKHFGGLQELSRASIDEIAKAPGISKKLAELI
YANLHSE