Protein Info for GFF2100 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Uracil-DNA glycosylase, family 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00628: uracil-DNA glycosylase
  • amino acids 6 to 214 (209 residues), 295.1 bits, E=1.6e-92
• PF03167: UDG
  • amino acids 51 to 210 (160 residues), 70 bits, E=1.2e-23

Best Hits

Swiss-Prot: 100% identical to UNG_SALCH: Uracil-DNA glycosylase (ung) from Salmonella choleraesuis (strain SC-B67)

KEGG orthology group: K03648, uracil-DNA glycosylase [EC: 3.2.2.-] (inferred from 100% identity to sea:SeAg_B2757)

MetaCyc: 91% identical to uracil-DNA glycosylase (Escherichia coli K-12 substr. MG1655)
RXN0-2584 [EC: 3.2.2.27]

Predicted SEED Role

"Uracil-DNA glycosylase, family 1" in subsystem DNA Repair Base Excision

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.-

Use Curated BLAST to search for 3.2.2.- or 3.2.2.27

Protein Sequence (229 amino acids)

>GFF2100 Uracil-DNA glycosylase, family 1 (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MATELTWHDVLADEKQQPYFINTLHTVAGERQSGITVYPPQKDVFNAFRFTELGDVKVVI
LGQDPYHGPGQAHGLAFSVRPGIAPPPSLVNMYKELEASIPGFVRPAHGYLESWARQGVL
LLNTVLTVRAGQAHSHASLGWETFTDKVISLINQHREGVVFLLWGSHAQKKGAIIDPQRH
HILKAPHPSPLSAHRGFFGCNHFALTNQWLEQHGEKTIDWTPVLPAESE