Protein Info for PS417_10690 in Pseudomonas simiae WCS417

Annotation: acyl-CoA synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 702 transmembrane" amino acids 597 to 611 (15 residues), see Phobius details PF13380: CoA_binding_2" amino acids 26 to 133 (108 residues), 40.9 bits, see alignment E=3.8e-14 PF13607: Succ_CoA_lig" amino acids 155 to 288 (134 residues), 113.2 bits, see alignment E=1.2e-36 PF13549: ATP-grasp_5" amino acids 475 to 696 (222 residues), 182.9 bits, see alignment E=8.7e-58

Best Hits

KEGG orthology group: None (inferred from 82% identity to pfl:PFL_2713)

Predicted SEED Role

"Acetyl-CoA synthetase (ADP-forming) alpha and beta chains, putative" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UAE5 at UniProt or InterPro

Protein Sequence (702 amino acids)

>PS417_10690 acyl-CoA synthetase (Pseudomonas simiae WCS417)
MSQAIRDNLKRLLAPRHLAFVGGRSMARALKRCADGGFTGPMWLVNPQHDSLDGIPCVRR
VTDLPCGPDAVFIATNRELTLTCVAELAAIGTGGAICYASGFAETGAGGAALQQQLLKAA
GDMALLGPNCYGLLDYLHCSALWPVAHGGKSVEKGVAVLTQSGNFAYNLSMSDRSLPVAY
MASVGNQAQLGVAELMDVLLDEPRVTAIGLHLEGLKNVPGFARAAHKALEKGIPIIALKT
GVSQIGAELALSHTSSLSGSDALYDSLFARLGVIRVSGPVSFVETLKAAACGNLPEGNRL
IALACSGGDAGLIADYAERNHLALPTLDDDQRAELAQVLPSYANLVNPLDFTTAIWGDRD
ALDAMLDTVLRTAADAAMLVLDYPAEFTGERKECDLLLELFCAALGRHGKTGFVTSALPE
LLPPHARERLHAQGIAALQGVEDALAAWGRIADYPRNRRVLLERGESILEPLCPKALDDR
GEALDEWASKQALRAFGLTTPAGVLSTPGRAVSDAEMLGYPLVLKAVSAQLPHKTEAGAV
VLNLQNGRALTAALEQMRAHISAYAPHVVFDQLLLESMATPPLAELIVGIKRENDFGLAL
VIGAGGILVELLKDSRSLLLPTTDSAIRNALLSLRSAALLQGFRGREVADLDALVTAIRA
VADYACANAGQLLELDVNPLLVNAQGATAVDALIRLGDEHVR