Protein Info for GFF2096 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: D-2-hydroxyglutarate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 PF01565: FAD_binding_4" amino acids 41 to 178 (138 residues), 140.7 bits, see alignment E=2.7e-45 PF02913: FAD-oxidase_C" amino acids 217 to 458 (242 residues), 166.1 bits, see alignment E=1.2e-52

Best Hits

KEGG orthology group: None (inferred from 50% identity to rme:Rmet_1608)

Predicted SEED Role

"D-2-hydroxyglutarate dehydrogenase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (462 amino acids)

>GFF2096 D-2-hydroxyglutarate dehydrogenase (Hydrogenophaga sp. GW460-11-11-14-LB1)
LPATSILSALQKLLGPRGVLGADAIEERYLVDVLGNRGEAPLAVIRPADTAELSAALALC
HAQGVPVITQGGRTGLALGQLPRAGEIVLSTERMNAIEDIDADAGTATVQAGVILQTLQE
RVAPAGLMFPLDLGGRGSCTLGGNIATNAGGNRVLRYGMAREMVLGLEVVLADGTVLDGL
KPLLKNNTGPDLKHLFIGSEGVLGVITRAVLRLFPQPADRTVALCAVADFVRVKALLRHA
RAGLAGELTSFEVMWASYYDRAVTLLGRPAPIAPGNAFHVLIEASGTDAQTLQARVEQML
GSAIEQGTVADAVLAKSGAEIEELWRVRDLAIETSRLLDPIVPFDVSVPISRMDSFVAEV
QAAALAVDPRCDLLVFGHMADGNLHLAVHQPPDRPQAFDAIEQAVYGVVGRYRGSVSAEH
GIGWLKREYLGQSRSPAEIAVMRSLKATLDPRNILNPHRILS