Protein Info for GFF2095 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: TRAP-type C4-dicarboxylate transport system, small permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 176 transmembrane" amino acids 23 to 45 (23 residues), see Phobius details amino acids 58 to 76 (19 residues), see Phobius details amino acids 96 to 115 (20 residues), see Phobius details amino acids 134 to 154 (21 residues), see Phobius details PF04290: DctQ" amino acids 33 to 162 (130 residues), 96.4 bits, see alignment E=6.7e-32

Best Hits

Swiss-Prot: 35% identical to Y1030_HAEIN: Putative TRAP transporter small permease protein HI_1030 (HI_1030) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 47% identity to smk:Sinme_5362)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (176 amino acids)

>GFF2095 TRAP-type C4-dicarboxylate transport system, small permease component (Hydrogenophaga sp. GW460-11-11-14-LB1)
MRDDTPQPGALAGAGRAIVRTLEVLLVVCLLTMIAMVFGNVVLRYGFDGGLVLSEELSRF
AFVWMTFVGAILAAREGMHVGVDALLVALPDWAHRACLVLAEVLVIACCAVFVWGTWRQH
EVNASTVAAVSGLPMIWVFGVGYVTGGGIAFISLQRIVHILRGGSLEREIAPEGLE