Protein Info for GFF2090 in Sphingobium sp. HT1-2

Annotation: Transamidase GatB domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 PF09424: YqeY" amino acids 4 to 149 (146 residues), 144.7 bits, see alignment E=1.1e-46

Best Hits

KEGG orthology group: K09117, hypothetical protein (inferred from 90% identity to sjp:SJA_C1-14360)

Predicted SEED Role

"Transamidase GatB domain protein" in subsystem Macromolecular synthesis operon

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (150 amino acids)

>GFF2090 Transamidase GatB domain protein (Sphingobium sp. HT1-2)
MIRDTIKSAQVESMKAGDKDRLAAVRLILAKLKDRDIELRTASNVPDDDTVVVEVLQKMV
KQRRESIDMFKSGGRDELAAKEQAELDVIETFLPAQLSEDETKAAIEGIKSEIGAESVKD
MGKVMAVLKERHGAVIDMSKASGLVKAALS