Protein Info for PS417_01060 in Pseudomonas simiae WCS417

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 transmembrane" amino acids 14 to 36 (23 residues), see Phobius details amino acids 50 to 75 (26 residues), see Phobius details amino acids 84 to 102 (19 residues), see Phobius details amino acids 130 to 155 (26 residues), see Phobius details amino acids 158 to 165 (8 residues), see Phobius details amino acids 184 to 204 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 36 to 213 (178 residues), 85.1 bits, see alignment E=2.7e-28

Best Hits

Swiss-Prot: 52% identical to METI_SALTI: D-methionine transport system permease protein MetI (metI) from Salmonella typhi

KEGG orthology group: K02072, D-methionine transport system permease protein (inferred from 99% identity to pfs:PFLU0237)

MetaCyc: 51% identical to L-methionine/D-methionine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
RXN0-4522 [EC: 7.4.2.11]; 7.4.2.11 [EC: 7.4.2.11]; TRANS-RXN-383 [EC: 7.4.2.11]; TRANS-RXN0-510 [EC: 7.4.2.11]; TRANS-RXN0-511 [EC: 7.4.2.11]

Predicted SEED Role

"Methionine ABC transporter permease protein" in subsystem Methionine Biosynthesis or Methionine Degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U3D0 at UniProt or InterPro

Protein Sequence (214 amino acids)

>PS417_01060 ABC transporter permease (Pseudomonas simiae WCS417)
MWFDRLVQGAIDTLLMVGVSSLIALLVGIPLAVFLVTSDKGGIYQAPALNRVLGAFVNLF
RSIPFLILMVALIPFTRLIVGTTYGVWAAVVPLTIAATPFFARIAEVSLREVDHGLIEAA
QAMGCRRWHIIWHVLLPEALPGIVGGFTITLVTMINSSAMAGAIGAGGLGDIAYRYGYQR
FDTQIMLTVIVLLVLLVAVIQLGGDRLARGLNKR