Protein Info for GFF209 in Variovorax sp. SCN45

Annotation: Inosine-5'-monophosphate dehydrogenase (EC 1.1.1.205) / CBS domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01302: inosine-5'-monophosphate dehydrogenase
  • amino acids 7 to 456 (450 residues), 620.9 bits, E=6.9e-191
• PF00478: IMPDH
  • amino acids 7 to 475 (469 residues), 542.3 bits, E=8.9e-167
• PF00571: CBS
  • amino acids 94 to 138 (45 residues), 34.4 bits, 4.5e-12
  • amino acids 147 to 201 (55 residues), 39.3 bits, 1.4e-13
• PF01070: FMN_dh
  • amino acids 258 to 363 (106 residues), 25.9 bits, E=1e-09

Best Hits

Swiss-Prot: 65% identical to IMDH_ACICA: Inosine-5'-monophosphate dehydrogenase (guaB) from Acinetobacter calcoaceticus

KEGG orthology group: K00088, IMP dehydrogenase [EC: 1.1.1.205] (inferred from 99% identity to vpe:Varpa_2863)

MetaCyc: 60% identical to inosine 5'-monophosphate dehydrogenase (Escherichia coli K-12 substr. MG1655)
IMP dehydrogenase. [EC: 1.1.1.205]

Predicted SEED Role

"Inosine-5'-monophosphate dehydrogenase (EC 1.1.1.205)" in subsystem Purine conversions (EC 1.1.1.205)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (43/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (24/26 steps found)
• superpathway of purine nucleotide salvage (12/14 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• purine nucleotides degradation I (plants) (10/12 steps found)
• adenosine nucleotides degradation I (7/8 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (7/8 steps found)
• guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
• purine nucleotides degradation II (aerobic) (9/11 steps found)
• inosine 5'-phosphate degradation (3/4 steps found)
• ureide biosynthesis (5/7 steps found)
• superpathway of purines degradation in plants (12/18 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Drug metabolism - other enzymes
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.205

Use Curated BLAST to search for 1.1.1.205

Protein Sequence (489 amino acids)

>GFF209 Inosine-5'-monophosphate dehydrogenase (EC 1.1.1.205) / CBS domain (Variovorax sp. SCN45)
MRLLGKALTFDDVLLVPAFSQVLPKDTSLATKLSRNITLNLPLISAAMDTVTEARLAIAI
AQEGGMGIVHKNLTAQQQAAEVARVKRYESGVLRDPVVITPTHSVRQVMALSDQLGISGF
PVVDAGKVVGIVTGRDLRFENRYDVPVSEIMTRREKLITVPDGTTLAEAKALLNKYKLER
LLVINGDWELKGLITVKDITKQTSFPNAARDANGRLRVGAAVGVGDGTEERVEALVKAGV
DAIVVDTAHGHSAGVIERVRWVKKNYPQVDVIGGNIATGDAARALADVGADAVKVGIGPG
SICTTRIVAGVGVPQIMAVDSVATALQGTGIPLISDGGVRYSGDIAKAIAAGASTVMMGS
MFAGTEEAPGEIVLYQGRSYKSYRGMGSIGAMQQGSADRYFQESTTGNPNTDKLVPEGIE
GRVPYKGSIVSIVYQMAGGVRASMGYCGCATIADMQNKAEFVEITTAGIRESHVHDVQIT
KEAPNYRAE