Protein Info for PS417_10650 in Pseudomonas simiae WCS417

Annotation: methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 42 to 62 (21 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details amino acids 101 to 131 (31 residues), see Phobius details PF02308: MgtC" amino acids 19 to 139 (121 residues), 126.7 bits, see alignment E=6.5e-41 PF21770: MgtC_SapB_C" amino acids 158 to 232 (75 residues), 36 bits, see alignment E=8.4e-13

Best Hits

KEGG orthology group: K07507, putative Mg2+ transporter-C (MgtC) family protein (inferred from 98% identity to pfs:PFLU2179)

Predicted SEED Role

"Mg(2+) transport ATPase protein C"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UGB5 at UniProt or InterPro

Protein Sequence (238 amino acids)

>PS417_10650 methyltransferase (Pseudomonas simiae WCS417)
MQAINNINLESLVDTLVSLTAAFVLGGLIGFERQYRQRTAGLRTNVLVAVGAAIFVDMAS
RLGGAEGAVRVVAYVVSGIGFLGAGVIMREEGNVRGLNTAATLWASAAVGACAGADLVLE
ALLGTLFVLAANTLLRPIVNNINRQPLDVVSAEVTNILYVIARRTQQKAVLALLEAELAR
CNYPASDVDVRPFGTEEVEIEATLAVTSVDGDELDALVARISMSTLVVQAFWSPSTTE