Protein Info for GFF2086 in Sphingobium sp. HT1-2

Annotation: Transcription elongation factor GreA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 158 PF03449: GreA_GreB_N" amino acids 8 to 76 (69 residues), 96.4 bits, see alignment E=9.4e-32 TIGR01462: transcription elongation factor GreA" amino acids 8 to 155 (148 residues), 184.8 bits, see alignment E=5e-59 PF01272: GreA_GreB" amino acids 85 to 155 (71 residues), 88.7 bits, see alignment E=2e-29

Best Hits

Swiss-Prot: 87% identical to GREA_SPHAL: Transcription elongation factor GreA (greA) from Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)

KEGG orthology group: K03624, transcription elongation factor GreA (inferred from 93% identity to sjp:SJA_C1-14400)

Predicted SEED Role

"Transcription elongation factor GreA" in subsystem Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (158 amino acids)

>GFF2086 Transcription elongation factor GreA (Sphingobium sp. HT1-2)
MATVEKMPMLQVGYDKLNAQLRELKAERPLIVDAIEEARAHGDLSENAEYHAAKERQGQV
EATISDLEDKLSRAQIIDPTTLSGNKIVFGATVTLLDEDDKPVKYQIVGQAEADAKAGMI
SYNSPLGRALIGREVGDEVEVSVPSGDKFYLVDKIAFI