Protein Info for GFF2085 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 592 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 41 to 63 (23 residues), see Phobius details PF07219: HemY_N" amino acids 26 to 132 (107 residues), 95.7 bits, see alignment E=9.2e-32

Best Hits

KEGG orthology group: K02498, HemY protein (inferred from 70% identity to azc:AZC_0258)

Predicted SEED Role

"Uncharacterized protein EC-HemY, likely associated with heme metabolism based on gene clustering with hemC, hemD in Proteobacteria (unrelated to HemY-type PPO in GramPositives)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (592 amino acids)

>GFF2085 hypothetical protein (Xanthobacter sp. DMC5)
VIRLVLLLILLAAAAFGVSWLADRPGEIAVVWEGWRVETTVPVALAVIAVVSGVLLLLWR
LLSLLVRSPKLIAAFSRRRKREKGWQAVSRGLLAVGIGDNAAVRQARHDAARLLPHEPLT
HLLTAQAAQLDGKPEVAIAAFRAMVDDPSTRLLGLRGLHMEARKAGDKAAAYAIAEEAAS
AAPTLGWAADAVIEARCAAGDYAGARAVLERQMAQKGIDKAQYKRRRAVLLAAEAIALEQ
TDPLVAREKAVEAVRLAPTLVPAAACAGRLLGAAGELRKAAKIVETAFAANPHPELADVE
AYLRPGDAALDRLKRIRTLANRAPSQRESAIALARAAIDAQEFRQARLVLEPLLDDPSQR
VCLLMAELEAAEHADIGKAREWTARAVRANRDPAWIADGVVSDRWAPVSPVSGRLDAFVW
EVPPGVSATPILEHEAERVKAAIAAVRASEEAKVAEKKIAEQKLAEKKLAELKAAEPKPA
EVAPAAAAESAAAGAPVVVVEAPAPVTTVAAKPPEPKGPEPKAAEPVPVILAPPAGNGAD
ARGRARQNGKPETGKKVDAIVALPPLPDDPGPEADATEEPDPSSKSRRLMGL