Protein Info for GFF2081 in Xanthobacter sp. DMC5

Annotation: Glutaminase 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03814: glutaminase A
  • amino acids 33 to 326 (294 residues), 348.1 bits, E=1.8e-108
• PF04960: Glutaminase
  • amino acids 43 to 326 (284 residues), 373.6 bits, E=3.2e-116

Best Hits

Swiss-Prot: 52% identical to GLSA_ANAVT: Glutaminase (glsA) from Anabaena variabilis (strain ATCC 29413 / PCC 7937)

KEGG orthology group: K01425, glutaminase [EC: 3.5.1.2] (inferred from 80% identity to xau:Xaut_1163)

Predicted SEED Role

"Glutaminase (EC 3.5.1.2)" in subsystem Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 3.5.1.2)

MetaCyc Pathways

• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• L-glutamate and L-glutamine biosynthesis (5/7 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• D-Glutamine and D-glutamate metabolism
• Glutamate metabolism
• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.2

Use Curated BLAST to search for 3.5.1.2

Protein Sequence (341 amino acids)

>GFF2081 Glutaminase 1 (Xanthobacter sp. DMC5)
MPVVGKGEEMDSSLHAAPAVPGGYGLETVVRHTYERTRTDTSGALADYIPELALVDPDRF
GIAAVSVEGEVVSVGDADVAFTIQSISKAFAFCLALEVAGREKVLSRVGVEPSGDAFNAI
VFDAETNRPFNPMVNAGAITVSGLLVEHLGAEALDFVLDRFSAAAGRRLVVDEAVFRSEA
ETAHRNRGIAHLLTSAGALTAGVDATLDLYFRQCSILVTAGDLARMGATLANIGENPLTG
TTAFAVDAVRSTLAVMFTCGMYNFAGNWAFDVGVPAKSGVGGGILGVVNRQLGIATYSPR
LDGRGNSVRGIAAFRELAEELGLHVFDPTNRGSAMLTAFGR