Protein Info for GFF2081 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Phosphate acetyltransferase (EC 2.3.1.8), ethanolamine utilization-specific

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01515: PTA_PTB
  • amino acids 2 to 320 (319 residues), 401.4 bits, E=1.7e-124
• TIGR00651: phosphate acetyltransferase
  • amino acids 17 to 319 (303 residues), 328.3 bits, E=2.6e-102

Best Hits

Swiss-Prot: 100% identical to EUTD_SALTY: Ethanolamine utilization protein EutD (eutD) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K04020, phosphotransacetylase (inferred from 98% identity to sew:SeSA_A2700)

MetaCyc: 89% identical to phosphate acetyltransferase EutD (Escherichia coli K-12 substr. MG1655)
Phosphate acetyltransferase. [EC: 2.3.1.8]

Predicted SEED Role

"Phosphate acetyltransferase (EC 2.3.1.8), ethanolamine utilization-specific" in subsystem Ethanolamine utilization (EC 2.3.1.8)

MetaCyc Pathways

• superpathway of N-acetylneuraminate degradation (22/22 steps found)
• mixed acid fermentation (16/16 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (18/19 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (9/9 steps found)
• heterolactic fermentation (15/18 steps found)
• ethanolamine utilization (5/5 steps found)
• pyruvate fermentation to acetate I (3/3 steps found)
• pyruvate fermentation to acetate II (3/3 steps found)
• pyruvate fermentation to acetate IV (3/3 steps found)
• pyruvate fermentation to acetate VII (3/3 steps found)
• superpathway of acetate utilization and formation (3/3 steps found)
• acetate and ATP formation from acetyl-CoA I (2/2 steps found)
• acetylene degradation (anaerobic) (4/5 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (3/4 steps found)
• pyruvate fermentation to acetate and lactate II (3/4 steps found)
• sulfoacetaldehyde degradation I (1/2 steps found)
• superpathway of Clostridium acetobutylicum acidogenic fermentation (6/9 steps found)
• lactate fermentation to acetate, CO₂ and hydrogen (Desulfovibrionales) (5/8 steps found)
• superpathway of L-alanine fermentation (Stickland reaction) (5/9 steps found)
• sulfolactate degradation II (1/4 steps found)
• acetyl-CoA fermentation to butanoate (3/7 steps found)
• methanogenesis from acetate (2/6 steps found)
• superpathway of sulfolactate degradation (2/6 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (7/13 steps found)
• superpathway of taurine degradation (1/6 steps found)
• L-lysine fermentation to acetate and butanoate (3/10 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (8/17 steps found)
• gallate degradation III (anaerobic) (3/11 steps found)
• purine nucleobases degradation II (anaerobic) (12/24 steps found)
• superpathway of methanogenesis (2/21 steps found)
• superpathway of L-lysine degradation (14/43 steps found)

KEGG Metabolic Maps

• Propanoate metabolism
• Pyruvate metabolism
• Taurine and hypotaurine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.8

Use Curated BLAST to search for 2.3.1.8

Protein Sequence (338 amino acids)

>GFF2081 Phosphate acetyltransferase (EC 2.3.1.8), ethanolamine utilization-specific (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MIIERARELAVRAPARVVFPDALDERVLKAAHYLQQYGLARPVLVASPFALRQFALSHRM
AMDGIQVIDPHSNLSMRQRFAQRWLARAGEKTPPDAVEKLSDPLMFAAAMVSAGEADVCI
AGNLSSTANVLRAGLRVIGLQPGCKTLSSIFLMLPQYAGPALGFADCSVVPQPTAAQLAD
IALASADTWRAITGEEPRVAMLSFSSNGSARHPNVANVQQATELVRERAPQLLVDGELQF
DAAFVPEVAAQKAPDSPLQGRANVMIFPSLEAGNIGYKITQRLGGYRAVGPLIQGLAAPL
HDLSRGCSVQEIIELALVAAVPRQADVSRERSLHTLVE