Protein Info for PS417_10605 in Pseudomonas simiae WCS417

Annotation: LuxR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 496 PF13188: PAS_8" amino acids 14 to 51 (38 residues), 23.5 bits, see alignment 1.4e-08 amino acids 142 to 193 (52 residues), 23.3 bits, see alignment 1.6e-08 amino acids 267 to 319 (53 residues), 17.7 bits, see alignment 9.1e-07 PF08448: PAS_4" amino acids 22 to 136 (115 residues), 24 bits, see alignment E=1.3e-08 PF13426: PAS_9" amino acids 24 to 136 (113 residues), 16 bits, see alignment E=4.1e-06 amino acids 157 to 198 (42 residues), 26.1 bits, see alignment 3e-09 amino acids 280 to 379 (100 residues), 38.4 bits, see alignment E=4.4e-13 TIGR00229: PAS domain S-box protein" amino acids 140 to 261 (122 residues), 38.5 bits, see alignment E=5.8e-14 amino acids 263 to 387 (125 residues), 50.4 bits, see alignment E=1.2e-17 PF00989: PAS" amino acids 276 to 374 (99 residues), 30.9 bits, see alignment E=8.2e-11 PF00196: GerE" amino acids 428 to 482 (55 residues), 62.1 bits, see alignment 1.1e-20

Best Hits

KEGG orthology group: None (inferred from 93% identity to pfs:PFLU2169)

Predicted SEED Role

"Sensory box transcriptional regulator, LuxR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TYC3 at UniProt or InterPro

Protein Sequence (496 amino acids)

>PS417_10605 LuxR family transcriptional regulator (Pseudomonas simiae WCS417)
MTQDVLAKETNRRQLQQIISGLSDGVILAEMDQTILWANEAALAMHGVGDVMGLGADGQQ
YAKRFALRYRNNHPIQPENYPLARAAAGDEFSDVVVEVTPTADEEKTWVHRLRSLVITDS
RGEPELLVLILSDATEWASAEQRFEKTFNANPAPAVICRLSDLRYIKVNQGFLEMTGYNR
DQVIGKSVYELDVLEQAERKDLAIQRLGEGATIPQMQAELRLPEGGSKLVIVAGQPLDMN
EEDCMLFSFMDLEPRRKAEIALRQSEERFAKSFRLTPVPTLVCSASNRQVVDINEAFMSI
TGYTSEELIGKSIEDISFIDSPQAGAQLFTTLEKAGNLDGQDLKVRKKGNEVIDCVVSAD
TVIIEDVPCYLLVMMNITERKRSELELVAAIEEVMQDASWFSQTLIEKLANAKSVNSPNK
PNIAYTDLTARERDVLGLICEGLADKEIASRLTLAPNTVRNHVATVYSKLGVHSRSAAIV
WARERGLFAGELRVKK