Protein Info for GFF2080 in Methylophilus sp. DMC18

Annotation: Glutathione-regulated potassium-efflux system protein KefB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 563 transmembrane" amino acids 17 to 38 (22 residues), see Phobius details amino acids 47 to 70 (24 residues), see Phobius details amino acids 78 to 102 (25 residues), see Phobius details PF02254: TrkA_N" amino acids 128 to 249 (122 residues), 70.2 bits, see alignment E=1e-23 amino acids 294 to 402 (109 residues), 68.8 bits, see alignment E=2.6e-23

Best Hits

KEGG orthology group: None (inferred from 57% identity to mfa:Mfla_2071)

Predicted SEED Role

"Potassium channel protein" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (563 amino acids)

>GFF2080 Glutathione-regulated potassium-efflux system protein KefB (Methylophilus sp. DMC18)
MTLNQIVFWILRRMRAPLLMLIVSYAIAMIGFVLIPGVNDRGQAYHLNFFDAFYILSYTA
TTIGFGELPYPFTTPQRLWMTFSIYVTVISWFYAIGAIIGLFQEGALKQAFKTAIFQRDV
KNLMEPFYLICGYGETGGELVRALDRNELRVVVLERSPERVNELELTNYQFHIPHLCADA
KLSEVLLYAGIKNPMCRGVAALTDDDHANLAISVAVKLIKPGLPVLARVQDDVIAANMAS
FGTDRIINPYHIFGEHLAMRLNALGTYLLHEWLTRAPGDAIETPAAIPQGHWIACGFGRF
GKSVVKSLQNEAMHVTIIEADPAGTQCEQCIIGSGVESHILKQAGIEQAVGIVAGTDNDI
NNLSIVMTALELNPNLFVIIRKNKRHNEPLFQHFDADITMQPSDVIAHTCLSYMVSPMLA
EFLATARHQGNAWANAVIAQLVSKLGEQVPDTWDITIADDMAVAVCGLMQQGLGPALKHL
LMNPAGQQRHEMPVVPLMLLRAGEKMLLPDLATPLEMGDKILFCGLDQAKSIQRYLLHDL
KTLHYLVTGNEMPETWIGRWLKQ