Protein Info for PS417_10595 in Pseudomonas simiae WCS417

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 46 to 69 (24 residues), see Phobius details amino acids 77 to 95 (19 residues), see Phobius details amino acids 101 to 120 (20 residues), see Phobius details amino acids 141 to 159 (19 residues), see Phobius details amino acids 165 to 182 (18 residues), see Phobius details amino acids 214 to 235 (22 residues), see Phobius details amino acids 247 to 270 (24 residues), see Phobius details amino acids 280 to 299 (20 residues), see Phobius details amino acids 305 to 326 (22 residues), see Phobius details amino acids 346 to 363 (18 residues), see Phobius details amino acids 369 to 390 (22 residues), see Phobius details PF07690: MFS_1" amino acids 15 to 347 (333 residues), 123 bits, see alignment E=7.1e-40

Best Hits

KEGG orthology group: None (inferred from 67% identity to pfl:PFL_2763)

Predicted SEED Role

"Multidrug resistance protein B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UGB3 at UniProt or InterPro

Protein Sequence (397 amino acids)

>PS417_10595 MFS transporter (Pseudomonas simiae WCS417)
MLATIRNYPRTVNLLLSATLLLTLAKAITFPYLVIYLTSHFALDITQVGLVIGSSLIVGS
LLSVYGGFLVDRINSYRLLLAFSVLFVLGFIGTVLARNIWAFYSCLILINLAYAVIDIAV
KAGFASLLPEDARSEVFSIKYTLTNIGYAVGPFFGAMIAKLDISLPFILSALLGVSFFLL
YWRWGDRTLTTVDATQKPVPFLAVGRVLLRDHRLVCFTLGGVLSAVVFGQFTAWLSQYLV
TTTTAEYTYTVVSAVLTTNAVLVITLQYVIGRRISHRYLGQWLIAGLGMFMLGIVGFALS
TSVLWWVLAMAVFTVGEIIVFPAEYMFIDRIAPDHLRGMYYGAQNLSNLGAALGPVLCGL
VLASLPAHYMFYMLGAFIVGGGVFYFIGASLKANHPA