Protein Info for GFF2077 in Variovorax sp. SCN45

Annotation: Acetyl-CoA synthetase (ADP-forming) alpha and beta chains, putative

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 446 PF06863: DUF1254" amino acids 52 to 183 (132 residues), 161.8 bits, see alignment E=1e-51 PF06742: DUF1214" amino acids 316 to 426 (111 residues), 121.7 bits, see alignment E=2.2e-39

Best Hits

KEGG orthology group: None (inferred from 70% identity to dac:Daci_1374)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (446 amino acids)

>GFF2077 Acetyl-CoA synthetase (ADP-forming) alpha and beta chains, putative (Variovorax sp. SCN45)
MPATIDNELRTLAEEAVVYAFPLHEMSRMRAATSPQRTDIAGEAPKPHRWCNVFTHARQL
LGAGKSRVVTPNNDTLYTNAWLDLGDGPLVIDVPDTAGRYYVLGLLDFYTNPFAHIGQRL
TGTAARSFLVTPPGWRGEVPAAFREAGAHIEAPTRWLWVIGRILVDGPDDVPAVNALQEG
FVVRTLGDWQAGKTSSMPKPFDPACDPKAPLSAEHFAAQVNRALRENPPPARDAALLARF
APLGLGPDADALDEAQRTVLQDALDTVLPRLRKAQSGATTSSGWVQMPLVEGSFGDDHLA
RALVALKYIGMLESREATYPLAWHDASGRKLDGSGCYTLRFAPGNLPPVDAFWSLTMYDS
RDYMLVGNPIDRYAIGDRTPALRHDADGGLTLYIQHARPEGEAAQANWLPAPEGDFYLCL
RAYVPRAEMLDGRYALPALVRTGEAA